PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678458536
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 406aa    MW: 45737.4 Da    PI: 6.926
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678458536genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS394.61e-120344051373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl....fsevsPilkfshl 96 
                +++lL++cAe+v+ +d ++aq+lL+ ls  +sp gd+++Rl++ f++AL+ r ++   +   ++++  ++++  s+e a+++     +++v+P+++f++l
  678458536  34 MRHLLVSCAEVVARSDYAAAQRLLSVLSSGCSPCGDSTERLVHQFARALRLRCSGGIGGFRVSVNAGGSTSRGCSDEDAVVQSsylsLNQVTPFIRFCQL 133
                689****************************************************77777777777776666533333333333556************* PP

       GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl...vakrledlelee 193
                taNqaIlea++g + +Hi+Dfdi++G+QWp+L+qaLa+R  ++p+lRiTg g     + e l++tg+rLakfA++lg++f+f++l   + ++  ++  ++
  678458536 134 TANQAILEAIDGRQSIHILDFDIMHGVQWPPLMQALADR-YPTPTLRITGSGG----ELEILRRTGDRLAKFAHSLGLRFQFHPLillAGEDPVSVIASS 228
                **************************************9.899**********....99*************************9443222333445778 PP

       GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  + p+E+laVn+ + lhrll ++ +l+     +L+ +ks+sP +v v+e+ea+hn++ F +rf+eal++y+a+fdslea+lp++s+er  vE++++g+e
  678458536 229 VVILPEETLAVNFNHYLHRLLTDRDHLH----LFLRRIKSMSPIIVAVAEREANHNHPIFQHRFIEALNHYAAVFDSLEATLPPNSRERFAVEQMWFGKE 324
                88889****************5555555....5******************************************************************* PP

       GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                i+++va+eg+ rrerhe++++W  +++++GF++v+ls +a++qaklllr ++ s+gy+++  ++sl+lgW+++pL+svS+W
  678458536 325 ICDIVAAEGEFRRERHERFRSWDLMMRSSGFTNVQLSPFAVSQAKLLLRLHYpSEGYQLHIFNNSLCLGWQNQPLYSVSSW 405
                ********************************************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.5038385IPR005202Transcription factor GRAS
PfamPF035143.6E-11834405IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010223Biological Processsecondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MLGEEQEELM PLPLPPPQLQ LQLHVEPQPP LGQMRHLLVS CAEVVARSDY AAAQRLLSVL  60
SSGCSPCGDS TERLVHQFAR ALRLRCSGGI GGFRVSVNAG GSTSRGCSDE DAVVQSSYLS  120
LNQVTPFIRF CQLTANQAIL EAIDGRQSIH ILDFDIMHGV QWPPLMQALA DRYPTPTLRI  180
TGSGGELEIL RRTGDRLAKF AHSLGLRFQF HPLILLAGED PVSVIASSVV ILPEETLAVN  240
FNHYLHRLLT DRDHLHLFLR RIKSMSPIIV AVAEREANHN HPIFQHRFIE ALNHYAAVFD  300
SLEATLPPNS RERFAVEQMW FGKEICDIVA AEGEFRRERH ERFRSWDLMM RSSGFTNVQL  360
SPFAVSQAKL LLRLHYPSEG YQLHIFNNSL CLGWQNQPLY SVSSWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-594140525377Protein SCARECROW
5b3h_D1e-594140525377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for axillary (lateral) shoot meristem formation during vegetative development. Seems to act upstream of REVOLUTA. {ECO:0000269|PubMed:12730136}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678458536
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095666.10.0scarecrow-like protein 18
SwissprotQ9ZWC51e-120SCL18_ARATH; Scarecrow-like protein 18
TrEMBLS8CCG30.0S8CCG3_9LAMI; Lateral suppressor protein (Fragment)
STRINGXP_009765072.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112982225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.11e-107GRAS family protein
Publications ? help Back to Top
  1. Zhang B, et al.
    Novel function of a putative MOC1 ortholog associated with spikelet number per spike in common wheat.
    Sci Rep, 2015. 5: p. 12211
    [PMID:26197925]