PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678456464
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MYB
Protein Properties Length: 257aa    MW: 29006.2 Da    PI: 8.9043
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678456464genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.41e-103783347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE +++ +a +++ ++   +W  +a++ + g+t  +++++++ +
        678456464 37 KWTPEENKRFENALALYDKDtpdRWYNVASMTP-GKTVHDVINHYREL 83
                     8********************************.***********975 PP

2Myb_DNA-binding45.71.5e-14135179347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + +++G+g+W+ I+r + ++Rt+ q+ s+ qky
        678456464 135 PWTEEEHRQFLLGLRKYGKGDWRNISRNFVTTRTPTQVASHAQKY 179
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.6223388IPR017884SANT domain
Gene3DG3DSA:1.10.10.604.4E-53384IPR009057Homeodomain-like
SMARTSM007176.0E-103486IPR001005SANT/Myb domain
SuperFamilySSF466894.31E-133692IPR009057Homeodomain-like
PfamPF002494.9E-93783IPR001005SANT/Myb domain
CDDcd001672.36E-73784No hitNo description
Gene3DG3DSA:1.10.10.608.8E-13125183IPR009057Homeodomain-like
PROSITE profilePS5129421.045128184IPR017930Myb domain
SuperFamilySSF466892.09E-17130183IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-18131183IPR006447Myb domain, plants
SMARTSM007175.7E-13132182IPR001005SANT/Myb domain
CDDcd001671.97E-10135180No hitNo description
PfamPF002493.6E-12135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MNRGVGVVPS APSAHHSSSS ASSSNWLFFD QSSRFSKWTP EENKRFENAL ALYDKDTPDR  60
WYNVASMTPG KTVHDVINHY RELVEDITDI ESGAIPIPGY INNSFTLEWV SEKGGLKQRK  120
PSSRCSEHER KKGVPWTEEE HRQFLLGLRK YGKGDWRNIS RNFVTTRTPT QVASHAQKYF  180
IRQVAGGKDK KRSSIHDITM VSIEEPKAPE KTTTTASDDS KGKMTNHLHP HSSTEFSMNL  240
ELDSDAGLGQ HPAMYSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-19381001173RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678456464
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094978.11e-108transcription factor DIVARICATA-like
SwissprotQ8S9H73e-79DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A2G9I5K71e-104A0A2G9I5K7_9LAMI; Zuotin
STRINGPOPTR_0006s09860.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.16e-95MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]