PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678456039 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 146aa MW: 16742.9 Da PI: 6.1317 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.1 | 4.1e-27 | 3 | 52 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqvtfskRr g+ KKA+ELSvL+da++a+i+fss+g+ly yss 678456039 3 RIENPTSRQVTFSKRRSGLVKKAYELSVLTDAQIALIVFSSKGRLYQYSS 52 8***********************************************96 PP | |||||||
2 | K-box | 47.4 | 8e-17 | 80 | 136 | 15 | 70 |
K-box 15 eslqqelakLkkeienLqreqR.hllGedLesLslkeLqqLeqqLekslkkiRskKn 70 +e a L k+ie L + R +l+GedL+++++++L+ LeqqL++sl+k Rs+K+ 678456039 80 HGAAHETADLSKKIELLDDSARqKLMGEDLDDCTIEDLEALEQQLHQSLSKFRSRKH 136 5567899***********555527********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00265 | 4.01E-35 | 1 | 68 | No hit | No description |
SMART | SM00432 | 1.8E-29 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.01E-27 | 1 | 69 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 27.389 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.3E-25 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-16 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-16 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 8.996 | 79 | 146 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.3E-14 | 82 | 136 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MRRIENPTSR QVTFSKRRSG LVKKAYELSV LTDAQIALIV FSSKGRLYQY SSPSTIEETL 60 ERYKKIEEIW ECTVTEGSTH GAAHETADLS KKIELLDDSA RQKLMGEDLD DCTIEDLEAL 120 EQQLHQSLSK FRSRKHLDEL KEKVPA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1c7u_A | 2e-16 | 3 | 68 | 9 | 73 | MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM |
1c7u_B | 2e-16 | 3 | 68 | 9 | 73 | MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678456039 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011081162.1 | 1e-45 | MADS-box protein SOC1 | ||||
Swissprot | O82743 | 2e-41 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
TrEMBL | D1MDP7 | 6e-42 | D1MDP7_VITVI; Suppressor of overexpression of CO 1 | ||||
STRING | AES80025 | 1e-42 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22950.1 | 9e-44 | AGAMOUS-like 19 |
Publications ? help Back to Top | |||
---|---|---|---|
|