PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678453818
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family BES1
Protein Properties Length: 311aa    MW: 33552.4 Da    PI: 8.6836
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678453818genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822183.58.9e-5721271128
     DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslks 100
                ++++r ptwkErEnnkrRERrRRai+aki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kpl  ++ +g +a +sp ssl  s  s
  678453818   2 TSGTRLPTWKERENNKRRERRRRAISAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPL--EQEGGGFAAVSPGSSLYPSSAS 99 
                5899************************************************************************..788999**********999999 PP

     DUF822 101 salaspvesysaspksssfpspssldsi 128
                s+l+s v+ ++ +  ++++  pssl   
  678453818 100 SSLTSLVSCQNLRNVNNDSTDPSSLIPW 127
                9999999999999888888888876544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.7E-523131IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAISAKI FAGLRMYGNY KLPKHCDNNE VLKALCKEAG  60
WIVEEDGTTY RKGCKPLEQE GGGFAAVSPG SSLYPSSASS SLTSLVSCQN LRNVNNDSTD  120
PSSLIPWLKN LSSGSLPVSS KHSSNIFVAG GSVSAPVTPP MSSPGTPRMK NGRCDDPTSG  180
SPWPGQRFPF FPSSTPQSPG MQTPADSGWP SGVQTPQDEP SSPTFSWVSP SPFGFLSNGG  240
SRMLSPLQSG TCSPSPADQA ADVPMLDSVS TEFAFRNNAK GLLVRAWEGE RIHDECVHDE  300
LQLTLGNSRT R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A8e-25683372449Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B8e-25683372449Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C8e-25683372449Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D8e-25683372449Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678453818
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101448.11e-129BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV883e-84BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A2G9HVA01e-126A0A2G9HVA0_9LAMI; Uncharacterized protein
STRINGMigut.M00997.1.p1e-115(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19842464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-73BES1/BZR1 homolog 4