PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678453508
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 766aa    MW: 86028.4 Da    PI: 4.7632
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678453508genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3634.4e-1113927631373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA+av+++d ++a + L+r+ +++sp+g ++qRla++f+ +L+arl +++++l+++l+ ++ +     e+l+a+++f  ++P+ k+  + aN+
  678453508 392 LRTLLITCAQAVAADDRRAAYEQLKRIDQHSSPTGGAFQRLAHVFASGLRARLGGTGNQLCASLTHRKMT---AFEKLKAYQVFLCACPFKKLPIFFANK 488
                6789*********************************************************999999988...9************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 I  a+++++++Hi+Df+i +G+QWp L+q+L++Rp+gpp+lRiTg++ p++g   +e++eetg+rLak++e++gvpfe+++++++++e+++le+L++ +
  678453508 489 LIGLAASEAHTLHIVDFGILYGFQWPMLIQELSERPGGPPKLRITGIELPQPGfrPSERVEETGRRLAKYCERFGVPFEYQPIATQNWENIKLEDLKIVR 588
                ****************************************************9******************************999************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E++aVn+ ++l  llde+v ++s+rd++L+l+++++P++ v +    + +++ Fl+rf eal +ysalfd+++a++pr++ er+  E+ ++gre+ nv+
  678453508 589 DEVVAVNCLFRLGLLLDETVVVDSPRDKLLRLIRKMKPDIYVNAVTSGSFSAPFFLTRFKEALFHYSALFDMFDATIPRDNTERVDFEQDFFGREVINVI 688
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                acegaer+er et+++W++r  +aGFkp p++e+++k+ ++  +  + + +   e+ +++++gWk+r + + S+W
  678453508 689 ACEGAERTERPETYKQWHARHVRAGFKPFPVNEEIMKKLRSKSASGYHKDFLFGEDGNWMLQGWKGRIICASSCW 763
                *****************************************999988788************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.056366744IPR005202Transcription factor GRAS
PfamPF035141.5E-108392763IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MIEQFSSLRV SGLQVASMDP RLSEIFDASN GYKFDGDDFF TSCGQSEYPA NDINHDMDLK  60
FLDDLSLRTS PDLHIFAPSS SVSYETESPD DQDSDEVLKF LNMILVEENL EERPSMFHDP  120
LALQATERSL YEVIGQEYPP SHYSPDIYLD QTSDSPESII VSSSDYVSSS NGGSNSVDAQ  180
WTLDPGEYNS PLEQPYQQGT SNSFVQENSR SLSAPTNPLQ AKSNPDNLNS FDSTDFIKNF  240
FSSSESILQF KKGMEKASKF LPANNQLIID LEQSLPKKSE DMPVPAIEVE SSDINEPANA  300
IRRRKHNFPE DENAENLERN SKQSAIHVEE VELSEFFDRI LLCKDSQGSE FCGQAPKLPA  360
SERSAGQGVL ENGSSGKSQT KNSDGEGDSA DLRTLLITCA QAVAADDRRA AYEQLKRIDQ  420
HSSPTGGAFQ RLAHVFASGL RARLGGTGNQ LCASLTHRKM TAFEKLKAYQ VFLCACPFKK  480
LPIFFANKLI GLAASEAHTL HIVDFGILYG FQWPMLIQEL SERPGGPPKL RITGIELPQP  540
GFRPSERVEE TGRRLAKYCE RFGVPFEYQP IATQNWENIK LEDLKIVRDE VVAVNCLFRL  600
GLLLDETVVV DSPRDKLLRL IRKMKPDIYV NAVTSGSFSA PFFLTRFKEA LFHYSALFDM  660
FDATIPRDNT ERVDFEQDFF GREVINVIAC EGAERTERPE TYKQWHARHV RAGFKPFPVN  720
EEIMKKLRSK SASGYHKDFL FGEDGNWMLQ GWKGRIICAS SCWAPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-4639976525379Protein SCARECROW
5b3h_D1e-4639976525379Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678453508
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089502.10.0scarecrow-like protein 14
RefseqXP_020552354.10.0scarecrow-like protein 14
RefseqXP_020552355.10.0scarecrow-like protein 14
TrEMBLA0A2G9I6D90.0A0A2G9I6D9_9LAMI; Uncharacterized protein
STRINGMigut.D02079.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14