PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678453215 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 113aa MW: 12825.2 Da PI: 8.0942 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32.2 | 2.4e-10 | 15 | 46 | 2 | 34 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkg 34 g WT+eEde+l++ ++ G+g+W++++++ g + 678453215 15 GQWTAEEDEKLIQWIQANGPGNWRSVPKKAG-T 46 78***************************99.4 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-12 | 5 | 44 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.44 | 9 | 77 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.44E-8 | 9 | 45 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.2E-4 | 13 | 75 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-8 | 15 | 46 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.08E-6 | 17 | 46 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MGRSPCCDKS GLKQGQWTAE EDEKLIQWIQ ANGPGNWRSV PKKAGTLFHF IQYYDGLGHP 60 NSESCRSRAS EVREELPTPV DELPEAGYQE GEVHFRGRRG PHPPSQHSRK QVR |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678453215 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | B7ZYQ3 | 7e-24 | B7ZYQ3_MAIZE; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28110.1 | 4e-20 | myb domain protein 41 |