PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678449798
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 745aa    MW: 84309.3 Da    PI: 5.521
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678449798genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.21.3e-993717421373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA+ v++gd++ a++ L++++++   +g + + +   f +AL+arl ++++ely++   ++ +    se l+++k++  ++P+ k+  l aN+
  678449798 371 LRSLLISCAQSVAAGDHRTAEEQLKQIEQHLPTNGAAHNGVGRLFCRALRARLGGTGNELYASQIQRKLT---ASELLKIYKVYLSTCPFKKLPVLFANE 467
                689****************************************************999999776666665...99************************* PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +I  a+++++++Hi+Df+i +G++Wp+L+q+L++Rp+gpp+lRiTg++ p+ g   +e++eetg+ L+kf+e++gv++e+++++++++ed++le+L++ +
  678449798 468 MIISAASEASTLHIVDFGILYGFHWPTLIQQLSQRPGGPPKLRITGIELPQRGfrPAERVEETGRHLKKFCERFGVSLEYHPIASQHWEDIKLEDLKIVK 567
                ***************************************************99******************************999************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                gE+l  n+ ++l r+ldesv+ +s+rd++L+++++++P v+v +  + ++ns+ Fl+rf eal ++++lfd+l + lpr + + +   +e  + ++ nvv
  678449798 568 GEVLCANCLFRLGRFLDESVAPDSPRDKLLRMIRKMKPSVFVNTVTNGSYNSPFFLTRFREALFHFTMLFDMLGTILPRGNPDLNEFIQEHYALDVINVV 667
                *********************************************************************************7777766666999****** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                acegaer+er et+++W++r  +aGFkp pl+e+++k+ ++  + ++   +  +++ +++++gWk+r L + S+W
  678449798 668 ACEGAERVERPETYKQWKSRHLAAGFKPHPLQEETMKKLRSRSKATSHIDFLFDKDGNWMLQGWKGRILSASSCW 742
                ***********************************************777************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.048345723IPR005202Transcription factor GRAS
PfamPF035144.6E-97371742IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MDPQLRQFSD AANEFEFVYG DFFTSQTQSQ YLSTDVHHHM DFNVSDIPFL PLSPDPENCS  60
SPATASCETE SADDQDPGEM LKYLNMYLVE ENSDDMINTF HGPLVLQATE KSLYELIGQE  120
YPPLHMNIEA YPDQSTDTPE TTIDSSSGCT SGFCDDVTSF VDFQWVVDPS ENNSTLKQDH  180
RNGVSPNLFM QKKLQSLSIP VDDSEGHTDR TMLLHDMFNN EESILQFKRG MEAASKFLPT  240
DNKLIIDLDK YMLPEKSEDV MKVGVVKIEK NNIDGFELPL RGKRHHYPRD GDSENLERSI  300
KQSAVSVEDV DLSEYLERTL CCDDDEVLEL STKEAKLPGS KKGLPQGALA SHSSRRSRAK  360
KSDNNGDVVD LRSLLISCAQ SVAAGDHRTA EEQLKQIEQH LPTNGAAHNG VGRLFCRALR  420
ARLGGTGNEL YASQIQRKLT ASELLKIYKV YLSTCPFKKL PVLFANEMII SAASEASTLH  480
IVDFGILYGF HWPTLIQQLS QRPGGPPKLR ITGIELPQRG FRPAERVEET GRHLKKFCER  540
FGVSLEYHPI ASQHWEDIKL EDLKIVKGEV LCANCLFRLG RFLDESVAPD SPRDKLLRMI  600
RKMKPSVFVN TVTNGSYNSP FFLTRFREAL FHFTMLFDML GTILPRGNPD LNEFIQEHYA  660
LDVINVVACE GAERVERPET YKQWKSRHLA AGFKPHPLQE ETMKKLRSRS KATSHIDFLF  720
DKDGNWMLQG WKGRILSASS CWVSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-343756988328GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678449798
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089502.10.0scarecrow-like protein 14
RefseqXP_020552354.10.0scarecrow-like protein 14
RefseqXP_020552355.10.0scarecrow-like protein 14
TrEMBLA0A2G9I6D90.0A0A2G9I6D9_9LAMI; Uncharacterized protein
STRINGMigut.D02079.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-169SCARECROW-like 14