PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678449795
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 604aa    MW: 67859.8 Da    PI: 6.736
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678449795genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.43.2e-1112295983374
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                 lL++cA+av+++d + a+ lL r+++++s++gd+++Rla+yf+ AL+arla+ + ely+a+++++ s    ++ l+a+k++ +++P+ k+s+++aN++I
  678449795 229 GLLIQCAQAVANHDIRTANDLLIRIRQHSSSHGDSTERLAHYFATALEARLAGAGMELYAAMSTRRIS---AADILKAYKTLINACPFRKMSNMLANKTI 325
                68*************************************************************99999...9**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                 + + g   +Hi+Df+i +G+QWp+L+++L++Rp+gpp+l +Tg++ p++g   ++++ etg+rLak++++++vpfe+++ +a+++e++++e++++++gE
  678449795 326 NKLAVGVPSLHIVDFGILYGFQWPCLIRSLSERPGGPPKLHVTGIDLPQPGfrPADRVAETGRRLAKYCSRFNVPFEYSP-IAQKWETIKVEDIKFEEGE 424
                **************************************************9*****************************.7****************** PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                 l+Vn+ ++l+++ de+v++ s+rd+vL+l+++++P+++++   +  +n + F++rf eal  ys+lfd+++a++ re+++r  +E++l g+e+ n++ac
  678449795 425 LLVVNSLYRLQNVSDETVNSGSPRDAVLRLIRKMNPNMLIFGVLNGTYNIPYFVTRFREALFQYSSLFDMFDATMDREDKNRLLLEEQLYGKEALNIIAC 524
                **************************************************************************************************** PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                eg+er+e+ et+++W+ r ++ GF++vpl+ +++k +k  +++ +   ++v+e+ +++++gWk+r L+++S+W+
  678449795 525 EGSERVEQPETYRQWQVRNRRLGFRQVPLDAEIVKCVKNKVKTEYHIDFSVDEDGEWMLQGWKGRVLYALSCWQ 598
                ******************************************999667*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.02201578IPR005202Transcription factor GRAS
PfamPF035141.1E-108229598IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MDTLGFSSCF PQAKDFQGNC RSVVTFPDEN HFKVKPEVAA VNNSSTTQRN IPADVTQDSA  60
DGSHETDHSD AILKFISQML MEEEDLETRP CMLQDCLALQ ATEKSLYDVL LNNNYADSTT  120
SCGCAAGESS SGKYSSSSVS STGEVNSIGK KYHSREESDS IEVDRSSKHV ANCDFESEPI  180
EIYDNVLLCG RTDGVSCEKS KKLWRGHNRG RPKGSKKHGI TREVVDLTGL LIQCAQAVAN  240
HDIRTANDLL IRIRQHSSSH GDSTERLAHY FATALEARLA GAGMELYAAM STRRISAADI  300
LKAYKTLINA CPFRKMSNML ANKTINKLAV GVPSLHIVDF GILYGFQWPC LIRSLSERPG  360
GPPKLHVTGI DLPQPGFRPA DRVAETGRRL AKYCSRFNVP FEYSPIAQKW ETIKVEDIKF  420
EEGELLVVNS LYRLQNVSDE TVNSGSPRDA VLRLIRKMNP NMLIFGVLNG TYNIPYFVTR  480
FREALFQYSS LFDMFDATMD REDKNRLLLE EQLYGKEALN IIACEGSERV EQPETYRQWQ  540
VRNRRLGFRQ VPLDAEIVKC VKNKVKTEYH IDFSVDEDGE WMLQGWKGRV LYALSCWQPA  600
AKSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-492145991380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678449795
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089500.10.0scarecrow-like protein 30
SwissprotQ9XE581e-175SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A2G9I6F40.0A0A2G9I6F4_9LAMI; Uncharacterized protein
STRINGMigut.D02076.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-177SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]