PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678449415 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 275aa MW: 32415.7 Da PI: 10.6379 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.8 | 7.9e-30 | 76 | 126 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+lKKA+E+S+LCdaev +i+fs++gkl+ey+s 678449415 76 KRIENKINRQVTFSKRRAGLLKKAHEISILCDAEVGLIVFSHKGKLFEYAS 126 79***********************************************86 PP | |||||||
2 | K-box | 111.5 | 8.7e-37 | 153 | 241 | 12 | 100 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 + ++++ e++kLk++ie Lqr++Rh++GedL+s+s+k+Lq+LeqqL+++lk+iR++Kn++++e+i++lq+kek++qe+n L+kk++e 678449415 153 TSPANWTLEYSKLKARIELLQRNHRHYMGEDLNSMSMKDLQNLEQQLDTALKSIRTRKNQVIYESISDLQRKEKAIQEQNSILTKKIKE 241 56789*********************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.9E-41 | 68 | 127 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.113 | 68 | 128 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.59E-41 | 69 | 141 | No hit | No description |
SuperFamily | SSF55455 | 1.03E-33 | 69 | 158 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 70 | 124 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-31 | 70 | 90 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.7E-25 | 77 | 124 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-31 | 90 | 105 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-31 | 105 | 126 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.1E-31 | 154 | 239 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.554 | 155 | 245 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 275 aa Download sequence Send to blast |
MEKSGRQWRK RTLEKKEVSP PSKLRKDRAA AFPMVKLCDT FARVSILRLE WEKNKKERKK 60 ERKSKRGMGR GKVQLKRIEN KINRQVTFSK RRAGLLKKAH EISILCDAEV GLIVFSHKGK 120 LFEYASDSCM DRILEKYERY SFAERHLVAN EPTSPANWTL EYSKLKARIE LLQRNHRHYM 180 GEDLNSMSMK DLQNLEQQLD TALKSIRTRK NQVIYESISD LQRKEKAIQE QNSILTKKIK 240 EKEKEMEQRS QCATALQLPT PLLMTMGYHN LLQLH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_A | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-23 | 68 | 141 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 54 | 62 | KKERKKERK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678449415 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012831692.1 | 1e-106 | PREDICTED: truncated transcription factor CAULIFLOWER A | ||||
Swissprot | D7KWY6 | 1e-100 | AP1_ARALL; Floral homeotic protein APETALA 1 | ||||
TrEMBL | A0A2G9HS31 | 1e-111 | A0A2G9HS31_9LAMI; MADS box transcription factor | ||||
STRING | Migut.E00037.1.p | 1e-106 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA499 | 23 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-92 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|