PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678448941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 437aa    MW: 49538.8 Da    PI: 6.3604
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678448941genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.55.1e-131404321373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA +v+sg++e+a+ +L ++s las +gd+mqR+a+yf eALa r++r+++++yka++ ++ +    +ee+ ++k+fse  P++k+s++++Nq
  678448941  40 LIHLLVTCASHVASGNFENANLALDQISYLASAEGDTMQRIASYFSEALADRILRMWPGVYKAFSLTKIP--VAAEEMLVRKMFSEFLPFMKVSFVITNQ 137
                689*************************************************************999998..599999********************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                aI+ea+ege+ vHiiD+++ +++QW +Ll+ L+++p+gpp+lRiTg+++    +ke l +t++ L++ Ae+l+vp++f++ ++++le+l++e+Lrvk+gE
  678448941 138 AIVEAMEGEKIVHIIDLNAVEPMQWCTLLHWLSAQPQGPPHLRITGIHQ----QKEVLDQTARVLTEEAEKLDVPLQFTP-IVSKLENLDIEKLRVKTGE 232
                *************************************************....9**************************.7999*************** PP

       GRAS 201 alaVnlvlqlhrll...........................desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                a+a+++v+qlh+ll                            +s  +++++d++L+ ++ lsPkv+vv+eq+++hns+ ++er++e+l++y+alfd+le+
  678448941 233 AVAISSVMQLHELLasgnspksrhlvstnpnstgesvekgtVNSFRSQQRIDAFLSDLWALSPKVMVVTEQDSNHNSKGLMERLSESLYFYAALFDCLES 332
                ************************************999886677777789************************************************* PP

       GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                +lpr s er+k+E+++l++ei+n++aceg++r++rhe+lekW++r+e aGF++ pls++   qa+++l+ ++ dgy+++ e+g++ ++W drpL+s+ aW
  678448941 333 TLPRSSLERSKIEKMMLSEEIKNIIACEGTDRKQRHEKLEKWNQRFELAGFTKSPLSYYSLVQANRVLQSFNCDGYKIKVENGCASIYWYDRPLFSIAAW 432
                **************************************************************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.21214413IPR005202Transcription factor GRAS
PfamPF035141.8E-12840432IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MFQEETSSSS VSSSPIQMFP LSFSYPWLKD LKPEERGLYL IHLLVTCASH VASGNFENAN  60
LALDQISYLA SAEGDTMQRI ASYFSEALAD RILRMWPGVY KAFSLTKIPV AAEEMLVRKM  120
FSEFLPFMKV SFVITNQAIV EAMEGEKIVH IIDLNAVEPM QWCTLLHWLS AQPQGPPHLR  180
ITGIHQQKEV LDQTARVLTE EAEKLDVPLQ FTPIVSKLEN LDIEKLRVKT GEAVAISSVM  240
QLHELLASGN SPKSRHLVST NPNSTGESVE KGTVNSFRSQ QRIDAFLSDL WALSPKVMVV  300
TEQDSNHNSK GLMERLSESL YFYAALFDCL ESTLPRSSLE RSKIEKMMLS EEIKNIIACE  360
GTDRKQRHEK LEKWNQRFEL AGFTKSPLSY YSLVQANRVL QSFNCDGYKI KVENGCASIY  420
WYDRPLFSIA AWSSSRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-69284337379Protein SCARECROW
5b3h_A3e-69284336378Protein SCARECROW
5b3h_D3e-69284336378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678448941
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080382.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A2G9HIR50.0A0A2G9HIR5_9LAMI; Uncharacterized protein
STRINGMigut.D00643.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]