PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678442449 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 84aa MW: 9279.93 Da PI: 10.1322 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 122.8 | 1.2e-38 | 20 | 84 | 6 | 70 |
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 v+akG nPGlivll+vggl+++flvgny++y+yaqk+lP +kkkPvskkk+kre+lkqGv++PGe 678442449 20 VDAKGSNPGLIVLLLVGGLVVLFLVGNYVMYMYAQKTLPHKKKKPVSKKKMKRERLKQGVSAPGE 84 789*************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 0.006 | 20 | 84 | No hit | No description |
Pfam | PF04689 | 6.4E-38 | 21 | 84 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MDNGEDFEYQ TPPSFDPVGV DAKGSNPGLI VLLLVGGLVV LFLVGNYVMY MYAQKTLPHK 60 KKKPVSKKKM KRERLKQGVS APGE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678442449 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010104121.2 | 3e-27 | DNA-binding protein S1FA | ||||
Refseq | XP_024026346.1 | 3e-27 | DNA-binding protein S1FA | ||||
Swissprot | Q42337 | 1e-15 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | B9SGP8 | 6e-21 | B9SGP8_RICCO; DNA-binding protein S1FA, putative | ||||
STRING | Lus10015073 | 4e-25 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3174 | 22 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37120.1 | 4e-06 | S1FA-like DNA-binding protein |