PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678442144 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 157aa MW: 18199.3 Da PI: 9.5098 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.6 | 1.1e-32 | 78 | 136 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r +d+ +v++tYeg H h+ 678442144 78 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRHPRDEGIVVTTYEGMHSHP 136 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.5E-34 | 63 | 137 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.16E-29 | 71 | 137 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.171 | 73 | 138 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.4E-38 | 78 | 137 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.7E-26 | 79 | 136 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MDNYSSLFQP SSSSSSCAIP QNPLMNIISH APASDHHHTS NGIVGFDGQS PMVQKHEPKK 60 KERRPRYAFE TRSQVDILDD GYRWRKYGQK AVKNNKFPRS YYRCTHQGCN VKKQVQRHPR 120 DEGIVVTTYE GMHSHPVQKT DDNFEHILSQ MQIYTSY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-26 | 68 | 135 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-26 | 68 | 135 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678442144 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU912417 | 3e-32 | EU912417.1 Brassica napus WRKY75-1 transcription factor (WRKY75-1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012446088.1 | 1e-64 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_016686835.1 | 1e-64 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_016725404.1 | 1e-64 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_017621630.1 | 1e-64 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 6e-53 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A0D2NF01 | 3e-63 | A0A0D2NF01_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8J933 | 3e-63 | A0A1U8J933_GOSHI; probable WRKY transcription factor 75 | ||||
TrEMBL | A0A1U8MIL5 | 3e-63 | A0A1U8MIL5_GOSHI; probable WRKY transcription factor 75 | ||||
TrEMBL | H9XSZ5 | 3e-63 | H9XSZ5_GOSBA; WRKY transcription factor | ||||
STRING | Gorai.001G273100.1 | 5e-64 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2204 | 24 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 5e-54 | WRKY DNA-binding protein 75 |