PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678438722 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 81aa MW: 9178.46 Da PI: 8.8408 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 91.4 | 8.1e-29 | 11 | 65 | 2 | 57 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 ++v+Y+eC+kNhAas+G +avDGC+Efmps geeg+ al+CaAC CHR+FH+r v 678438722 11 REVTYQECRKNHAASVGKYAVDGCCEFMPS-GEEGSGGALRCAACSCHRSFHKRVV 65 579**************************9.999*******************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 9.0E-28 | 13 | 64 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 6.8E-25 | 14 | 63 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 24.378 | 15 | 64 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 8.0E-16 | 15 | 65 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MNPAPRKDNE REVTYQECRK NHAASVGKYA VDGCCEFMPS GEEGSGGALR CAACSCHRSF 60 HKRVVRRLCN NCRSYCRLLR H |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678438722 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009408377.1 | 1e-23 | PREDICTED: mini zinc finger protein 1-like | ||||
Swissprot | Q9SVL0 | 7e-21 | ZHD7_ARATH; Zinc-finger homeodomain protein 7 | ||||
TrEMBL | A0A2G9HH18 | 2e-29 | A0A2G9HH18_9LAMI; Uncharacterized protein | ||||
STRING | Migut.L01769.1.p | 4e-30 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1105 | 24 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50890.1 | 3e-23 | homeobox protein 28 |