PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678438610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 272aa    MW: 30725.4 Da    PI: 6.9497
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678438610genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS335.88e-1032271104373
       GRAS 104 eavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
                ea ++eer+Hi+Df+i qG+QW++LlqaLa+Rp+gpp++RiTg+++p s+  +   le +g+rLa + e++++p++f++ v     d++le+L+v pgEa
  678438610   2 EACKNEERIHIVDFQIAQGTQWMTLLQALAARPGGPPHVRITGIDDPMSKhaRGSGLELVGKRLAAVSEKFKIPVQFHP-VPVFAPDITLETLQVLPGEA 100
                899*******************************************998888999************************.6888999************* PP

       GRAS 202 laVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvace 301
                laVn+ lqlh+++desv+++++rd +L+++ksl+Pk+v++veqe+++n+++Fl rf+eal+yys++f+s+++ + r+ +eri+vE+++l+r+ivn++ace
  678438610 101 LAVNFPLQLHHTPDESVDVTNPRDGLLRMIKSLNPKIVTLVEQESNTNTAPFLPRFIEALDYYSSIFESIDVMMERDRKERINVEQQCLARDIVNIIACE 200
                **************************************************************************************************** PP

       GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                g+er+erhe l+kW +r+++aGF+p pl++++++ ++ ll+ ++ + y++ e++g+++lgWk+r+Lvs+SaW
  678438610 201 GKERVERHELLGKWTARFTMAGFRPFPLNSYVNSVIRDLLKCYS-ENYTLVERNGAMLLGWKHRNLVSASAW 271
                ****************************************9998.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.0441253IPR005202Transcription factor GRAS
PfamPF035142.8E-1002271IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
AEACKNEERI HIVDFQIAQG TQWMTLLQAL AARPGGPPHV RITGIDDPMS KHARGSGLEL  60
VGKRLAAVSE KFKIPVQFHP VPVFAPDITL ETLQVLPGEA LAVNFPLQLH HTPDESVDVT  120
NPRDGLLRMI KSLNPKIVTL VEQESNTNTA PFLPRFIEAL DYYSSIFESI DVMMERDRKE  180
RINVEQQCLA RDIVNIIACE GKERVERHEL LGKWTARFTM AGFRPFPLNS YVNSVIRDLL  240
KCYSENYTLV ERNGAMLLGW KHRNLVSASA WS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-512272121378Protein SCARECROW
5b3h_D1e-512272121378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678438610
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027064982.11e-169scarecrow-like protein 21
RefseqXP_027065135.11e-170chitin-inducible gibberellin-responsive protein 1-like
SwissprotQ69VG11e-148CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLA0A068UBH11e-167A0A068UBH1_COFCA; Uncharacterized protein
STRINGMigut.M01823.1.p1e-168(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34412448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-129GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]