PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678424356
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 590aa    MW: 65364.1 Da    PI: 5.8888
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678424356genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.58.5e-1302005671374
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                lv++L++cAeav+ ++++la+ l++++  la +++ +m+++a+yf+eALa++++r     y+    +++    s+ + + +  f+e++P+lkfsh+taNq
  678424356 200 LVHTLMACAEAVQLENFNLAKPLVKNIGLLAISQAGAMRKVATYFAEALARKIYR----PYHMNDHRPD----SAFTDMLQMHFYETCPCLKFSHFTANQ 291
                689****************************************************....4443344443....3444445556***************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                aIlea++g+++vH+iDf+++qG+QWpaLlqaLasR++gpp++R+Tg+g+p+ ++++ l+e+g rLa+fA++++v+fe++ +vak+l+dle  +L+++ +E
  678424356 292 AILEAFAGKNHVHVIDFSMKQGMQWPALLQALASREGGPPTFRLTGIGPPSLDETDYLQEVGFRLAEFAKTVNVQFEYRGFVAKSLADLEAAMLDIRDDE 391
                **************************************************************************************************** PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres......eerikvErellgrei 294
                ++aVn++++lh+ll++++++++    vL+l+++++P++++v+eqea+hns  Fl rf+eal+yys+lfdsle+  +  s      ++++ + +++lg++i
  678424356 392 TVAVNSIFELHQLLAKPGAIDK----VLRLIREVKPEILTVAEQEANHNSYFFLGRFTEALQYYSTLFDSLETCDGDGSadaavtRKNKIMTEAYLGQQI 487
                **************99999999....*********************************************998444443344556666677777***** PP

       GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 nvvaceg +r+erhe l +Wr+r+++aG++pv+l+++++ +a +ll+ +++dgy+vee++g+l+lgW++r+L+++SaW+
  678424356 488 FNVVACEGVDRIERHEPLTQWRNRFNSAGLEPVHLGSNVYRDAITLLAFYGGDGYTVEENHGCLMLGWHTRALLATSAWT 567
                *******************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.2E-2538113No hitNo description
PfamPF120419.9E-2538106IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098563.343174547IPR005202Transcription factor GRAS
PfamPF035142.9E-127200567IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MKRENLDHGD YFLSSASSCS MDKGKMRQCE VEEAGVDDEL FGVLGYKVKS SDMAAVAHKI  60
HQIEVAMGNA AVDGYSQLPA MDRTLHYNPS DLSSWLESML SGLNSLPGFD SSLDHFLPTS  120
TGGLAAVDLD FGSDLIAIPG KAVFANAQFH RTSPETRNQH QPPAKKAKTS PCVQDSAPPP  180
ELPQAPRSVL MDTQENGIRL VHTLMACAEA VQLENFNLAK PLVKNIGLLA ISQAGAMRKV  240
ATYFAEALAR KIYRPYHMND HRPDSAFTDM LQMHFYETCP CLKFSHFTAN QAILEAFAGK  300
NHVHVIDFSM KQGMQWPALL QALASREGGP PTFRLTGIGP PSLDETDYLQ EVGFRLAEFA  360
KTVNVQFEYR GFVAKSLADL EAAMLDIRDD ETVAVNSIFE LHQLLAKPGA IDKVLRLIRE  420
VKPEILTVAE QEANHNSYFF LGRFTEALQY YSTLFDSLET CDGDGSADAA VTRKNKIMTE  480
AYLGQQIFNV VACEGVDRIE RHEPLTQWRN RFNSAGLEPV HLGSNVYRDA ITLLAFYGGD  540
GYTVEENHGC LMLGWHTRAL LATSAWTMNG GYSERRNSRI SPNRLRAPEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A5e-6419556713378Protein SCARECROW
5b3h_D5e-6419556713378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678424356
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070609.10.0DELLA protein GAI1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A2G9HQV20.0A0A2G9HQV2_9LAMI; Uncharacterized protein
STRINGMigut.E00445.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein