PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678417385
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 538aa    MW: 59457.9 Da    PI: 5.8512
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678417385genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS397.11.8e-1211575381374
       GRAS   1 lvelLlecAeavssgdle........laqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                l++lL++cAe+v++ d+         +a+al++ l++++s +gdp++Rl ay++e+ +arl++s+s++yk l+++e  + +sse ++++++ +e++P++k
  678417385 157 LKKLLITCAEVVAEADTIsdrqvalsAAEALIEILEKRVSVSGDPLERLGAYMLEGVRARLLHSGSTIYKRLKCKEPINPTSSELMSYMHVIYEICPYYK 256
                5789********9966432333555599**************************************************999******************* PP

       GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                f+++     I e +e+e+r+HiiDf+i qG QW++++q+ + Rp+gpp lRiTgv++p+s   +   l+ +g  La++A+++gvpfef+  +a + ++++
  678417385 257 FAYVSSSVIISETMENESRIHIIDFQIAQGSQWVSFIQSVSRRPAGPPYLRITGVDDPQSAhaRGGGLQLVGLTLANVARSCGVPFEFHG-AAISGSEVQ 355
                ***********************************************************99889999***********************.8999***** PP

       GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                 e+L v++gEa+aVn+ ++lh+++de+vs+e++rd++L+lv+slsPkvv+++eqe+++n++ Fl+rf e+l+yy+a+f+s++a   re+++ri+ E++++
  678417385 356 WENLGVQHGEAVAVNFPYALHHIPDENVSIENHRDRLLRLVRSLSPKVVTLIEQESNTNATGFLQRFQESLNYYVAMFESIDAACQREDKKRISTEEHCV 455
                **************************************************************************************************** PP

       GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                +r++vn++aceg +r+erhe ++kWr+r+ +aGF+pv+ls  + k +  +l++++s+ y+v e +g+l+lgWk+r++ ++SaWr
  678417385 456 ARDVVNIIACEGPDRVERHEPFGKWRRRFAKAGFSPVRLSPAVGKAVCNMLKEYSSN-YTVGEGNGALYLGWKNRAMSTCSAWR 538
                *******************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.463131519IPR005202Transcription factor GRAS
PfamPF035146.4E-119157538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MDAPQDSEMS SSFHSSCSQP TPSQVQPYVF SGSRTGASSG QSLGGEFYTL ESTPDFVAYN  60
PSAASIRSPF SPQDSHYSLA SDHQHSPDLT VYDSAIPGSS GVEDENKLMH ALWVLRNELL  120
GPESDTDDIG CFGPQVIQPS PFSRYDRILE KAPNMDLKKL LITCAEVVAE ADTISDRQVA  180
LSAAEALIEI LEKRVSVSGD PLERLGAYML EGVRARLLHS GSTIYKRLKC KEPINPTSSE  240
LMSYMHVIYE ICPYYKFAYV SSSVIISETM ENESRIHIID FQIAQGSQWV SFIQSVSRRP  300
AGPPYLRITG VDDPQSAHAR GGGLQLVGLT LANVARSCGV PFEFHGAAIS GSEVQWENLG  360
VQHGEAVAVN FPYALHHIPD ENVSIENHRD RLLRLVRSLS PKVVTLIEQE SNTNATGFLQ  420
RFQESLNYYV AMFESIDAAC QREDKKRIST EEHCVARDVV NIIACEGPDR VERHEPFGKW  480
RRRFAKAGFS PVRLSPAVGK AVCNMLKEYS SNYTVGEGNG ALYLGWKNRA MSTCSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-5416453726378Protein SCARECROW
5b3h_A2e-5416453725377Protein SCARECROW
5b3h_D2e-5416453725377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678417385
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095941.10.0scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A022QK740.0A0A022QK74_ERYGU; Uncharacterized protein
STRINGMigut.M01421.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.11e-167SCARECROW-like 13