PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678407105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MYB
Protein Properties Length: 312aa    MW: 35218.9 Da    PI: 6.6733
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678407105genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-182572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l+++++++G g+W++ +r+ g++Rt+k+c++rw++yl
        678407105 25 RGPWTVEEDFALINYIARHGEGRWNSLSRCAGLKRTGKSCRLRWLNYL 72
                     89********************************************97 PP

2Myb_DNA-binding51.32.6e-1678121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
        678407105  78 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 121
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0522072IPR017930Myb domain
SuperFamilySSF466895.24E-3123119IPR009057Homeodomain-like
SMARTSM007172.4E-152474IPR001005SANT/Myb domain
PfamPF002493.3E-162572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-212679IPR009057Homeodomain-like
CDDcd001672.81E-122772No hitNo description
PROSITE patternPS0017504049IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129423.24673127IPR017930Myb domain
SMARTSM007171.3E-1477125IPR001005SANT/Myb domain
PfamPF002495.2E-1578121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2380126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEQMKTCSYG QSEEDSSAGG GDLRRGPWTV EEDFALINYI ARHGEGRWNS LSRCAGLKRT  60
GKSCRLRWLN YLRPDVRRGN ITLEEQLLIL ELHSRWGNRW SKIAQHLPGR TDNEIKNYWR  120
TRVQKHAKQL KCDVNSKQFK DTMRYLWMPR LVERIQASSA SAAVNDGVPV MGSSSSSSTT  180
SHLSDHSINT SMGGQAHVFG GFESGAWKIS SADLSSDSFG TPATEQTDFC NSNQYQVTLD  240
SGYQLPYVTQ QQPMNSQSGH AYLNQGPEFI DHNSSNQWIS GGGAPEDWYL GDDMWFFQHQ  300
EQPEANPLFS FS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24191251106B-MYB
1h8a_C1e-242211924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678407105
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021691580.11e-106transcription factor MYB108
TrEMBLA0A1J6IUC81e-104A0A1J6IUC8_NICAT; Transcription factor myb108
STRINGXP_009791846.11e-103(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-85myb domain protein 78