PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678397902 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 104aa MW: 11184.6 Da PI: 7.1828 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 54.9 | 1.7e-17 | 37 | 81 | 6 | 50 |
RWP-RK 6 sledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50 s+e++s+ Fs ++ dAA +Lgv+++vLK C ++G+ RWP+Rki+ 678397902 37 SFEEVSAVFSCTLSDAAESLGVSPSVLKNVCYENGLVRWPYRKIA 81 699****************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 12.901 | 22 | 103 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 4.9E-17 | 38 | 81 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MGTTQNSTPY QNRSQPTNTN PSPSPNPVSA QAPKVPSFEE VSAVFSCTLS DAAESLGVSP 60 SVLKNVCYEN GLVRWPYRKI AGGKTIEEIK KEAAMEKEAH CPAM |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678397902 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011082903.1 | 6e-37 | uncharacterized protein LOC105165548 | ||||
TrEMBL | S8C4V6 | 1e-29 | S8C4V6_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | PGSC0003DMT400020296 | 1e-26 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA10744 | 19 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G59580.2 | 5e-09 | Nin-like family protein |