PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678391779
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family BES1
Protein Properties Length: 455aa    MW: 49086.5 Da    PI: 6.0444
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678391779genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822185.62.1e-571292672145
     DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkss 101
                ++ r p+wkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e++++ g  a +sp ss  +s k+s
  678391779 129 SGARLPSWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWIVEEDGTTYRKGCKPVENTDVSGGLAIVSPGSSHRLSSKTS 228
                789*****************************************************************************************88555544 PP

     DUF822 102 alaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                  +s   s+ asp ss++ s+++++     +++sl+p+l++ls+
  678391779 229 FNPSSG-SSFASPVSSQYTSNVNYSA----DPNSLIPWLKNLSS 267
                444443.4445667777777666554....5578******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.5E-57130266IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MDQGYQLNQH TYYAANRIWP CGFLGEVERS HHLACDFFSK LAVEEALDSS YSLEAHENSD  60
VTSIIEPGCD FHQASSSLTP HSRFGLIGFC QFCSIISINI LLQLMGTYTS NIVAAESLEV  120
ADLQPGMTSG ARLPSWKERE NNKRRERRRR AIAAKIFAGL RMYGNYKLPK HCDNNEVLKA  180
LCNEAGWIVE EDGTTYRKGC KPVENTDVSG GLAIVSPGSS HRLSSKTSFN PSSGSSFASP  240
VSSQYTSNVN YSADPNSLIP WLKNLSSGSL PVSSKHPNHH YIPGGSISAP VTPPFSSPSP  300
GTPRMHSNWD DPASGSGWSG QRFPFFPSST PQSPGLQTPP DSGWLSGVQT PQDDGPCSPM  360
FSLVSANPFG IRDALSNGGS RVWTPGQSGT CSPAVPAGAD QTADVPMMEA VTSEFAFGSS  420
ARGLVKPWEG ERIHDECVPD DLELTLGSSN TRCRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A2e-23132203372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B2e-23132203372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C2e-23132203372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D2e-23132203372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678391779
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101448.11e-158BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-111BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A2G9HVA01e-157A0A2G9HVA0_9LAMI; Uncharacterized protein
STRINGMigut.M00997.1.p1e-144(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19842464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.18e-88BES1/BZR1 homolog 4