PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678388500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 750aa    MW: 84369.8 Da    PI: 4.8988
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678388500genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS357.71.7e-1093767471373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA+av+++d + a + L+++ +++sp+g   qRla++f+ +L+arl +++++l+++l+ ++ +     e+l+a+++f  ++P+ k+  l aN+
  678388500 376 LRTLLITCAQAVAADDRRTAYEQLKQIDQHSSPTGGVYQRLAHVFASGLRARLGGNGNQLCASLTHRKMT---AFEKLKAYQVFLCACPLKKLPILFANK 472
                6789*********************************************************999999998...9************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +I  a+ +++++Hi+Df+i +G+QWp L+q L++Rp+gpp+lRiTg++ p++g   +e++eetg+rL k++e++gvpfe+++++++++e+++le+L++ +
  678388500 473 MIGLAAGEAHTLHIVDFGILYGFQWPILIQHLSERPGGPPKLRITGIDLPQPGfrPAERIEETGRRLGKYCERFGVPFEYQAIATQNWENIKLEDLKIVR 572
                ****************************************************9******************************999************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E++aVn+ ++l  llde+v ++s+rd++Lkl+++++P++ v v  + + +++ F++rf eal yysalfd+++a++pr++ eri +E+ +lgre+ nv+
  678388500 573 DEVVAVNCLFRLGLLLDETVVVDSPRDKLLKLIRKMKPDIYVNVVTNGSFSAPFFVTRFKEALFYYSALFDMFDATIPRDNTERIDLEQDFLGREVINVI 672
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                acegaer+er et+++W++r  +aGFkp p++  ++k+ +   ++ + + +  +e+ +++++gWk+r + ++S+W
  678388500 673 ACEGAERTERPETYKQWHARHVRAGFKPFPMNAAIMKKLRNKNATAYHKDFLFDEDGNWMLQGWKGRIICATSCW 747
                *********************************************99888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.899350728IPR005202Transcription factor GRAS
PfamPF035145.8E-107376747IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MDPRLGEIVQ SSNGYKPDGY EFFTSYDHSE YPANGINHDL GLKFLDVSFL QTSPDPHMFA  60
PSSTAGYEME SPDDQDSDEV LKFLNMILVE ENLEERPSMF YDPLALQATE RSLYEVLGQD  120
YPPSHYNPDI YTDQPSDSPE SVIANSSGGV SSSNAGSSSI DHQWTLDPGE CSSTLEQGHQ  180
QGASNIFVQE VSRSEPALKN PFQVQSNPDT LNSFDSPDLI KNFFSSSESI SQFKKGMEEA  240
SKFLPTNNQL IIDLDQYTLP PKLEDVPVAA VKVENDEINE PSNSIRRRKY TFSEDENSEN  300
LERSSKQSAI HVDEAELSEY FDRVLLCNEG KASEHCTRQA KLPSSEKASM QGVLENVSNG  360
KSQTKTIDSD GDTVDLRTLL ITCAQAVAAD DRRTAYEQLK QIDQHSSPTG GVYQRLAHVF  420
ASGLRARLGG NGNQLCASLT HRKMTAFEKL KAYQVFLCAC PLKKLPILFA NKMIGLAAGE  480
AHTLHIVDFG ILYGFQWPIL IQHLSERPGG PPKLRITGID LPQPGFRPAE RIEETGRRLG  540
KYCERFGVPF EYQAIATQNW ENIKLEDLKI VRDEVVAVNC LFRLGLLLDE TVVVDSPRDK  600
LLKLIRKMKP DIYVNVVTNG SFSAPFFVTR FKEALFYYSA LFDMFDATIP RDNTERIDLE  660
QDFLGREVIN VIACEGAERT ERPETYKQWH ARHVRAGFKP FPMNAAIMKK LRNKNATAYH  720
KDFLFDEDGN WMLQGWKGRI ICATSCWVPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A9e-4838374925379Protein SCARECROW
5b3h_D9e-4838374925379Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678388500
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089502.10.0scarecrow-like protein 14
RefseqXP_020552354.10.0scarecrow-like protein 14
RefseqXP_020552355.10.0scarecrow-like protein 14
TrEMBLA0A2G9I6D90.0A0A2G9I6D9_9LAMI; Uncharacterized protein
STRINGXP_009606498.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14