PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678374763 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 172aa MW: 18164.5 Da PI: 9.3318 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 119.7 | 1.1e-37 | 16 | 75 | 3 | 62 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++l+cprC s ntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rk+ k+s 678374763 16 PEHLPCPRCSSINTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKSAKRS 75 57899**************************************************98875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 9.0E-27 | 17 | 73 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.9E-33 | 18 | 73 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.798 | 19 | 73 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 21 | 57 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MGGVGAITTI ERKPAPEHLP CPRCSSINTK FCYYNNYNFS QPRHFCKSCR RYWTHGGTLR 60 DIPVGGGTRK SAKRSRAVPS SEELRRAPPG GSFTSLLNSN NSNTHGAGVL GLGFSLDDVG 120 FGLGRPLWPL YGIAEGGVSA VAAHGDGGNF AGGECFPFAD IAAIPAPGSF FK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678374763 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ857251 | 1e-47 | DQ857251.1 Glycine max Dof2 mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009101840.1 | 1e-53 | PREDICTED: dof zinc finger protein DOF3.4-like | ||||
Refseq | XP_013646932.1 | 1e-53 | dof zinc finger protein DOF3.4 | ||||
Swissprot | Q39088 | 3e-39 | DOF34_ARATH; Dof zinc finger protein DOF3.4 | ||||
TrEMBL | A0A3P5ZJS9 | 3e-52 | A0A3P5ZJS9_BRACM; Uncharacterized protein | ||||
TrEMBL | M4EMJ0 | 3e-52 | M4EMJ0_BRARP; Uncharacterized protein | ||||
STRING | Bra030010.1-P | 4e-53 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4532 | 22 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50410.1 | 3e-38 | OBF binding protein 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|