PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678363687 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 198aa MW: 23005.2 Da PI: 9.7068 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91 | 5.8e-29 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtf+kRr g+lKKA+E+SvLCdaev viifss++kl ey+ 678363687 9 KRIENKINRQVTFTKRRSGLLKKAHEISVLCDAEVGVIIFSSKDKLSEYA 58 79***********************************************8 PP | |||||||
2 | K-box | 79.8 | 6.7e-27 | 78 | 175 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLq.reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +++++ + +++ s++ elakLk+++e +q +e Rh+ Ge++e+Ls++eL +Le++L+ slk+iR++K++++ e+i+ l kk k+lq+ n+ L kk++e 678363687 78 KQTNESKMETQTSWSIELAKLKARLEIMQtNESRHYNGEEIENLSMRELLSLEHRLDASLKHIRTRKDQVMNESISILHKKSKALQQGNNLLAKKVKE 175 5666677778899****************9899**************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.586 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.6E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.75E-32 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.54E-36 | 2 | 74 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.2E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.2E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.2E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.4E-20 | 86 | 173 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.328 | 88 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FTKRRSGLLK KAHEISVLCD AEVGVIIFSS KDKLSEYANH 60 SCMERILERY ERCSCAEKQT NESKMETQTS WSIELAKLKA RLEIMQTNES RHYNGEEIEN 120 LSMRELLSLE HRLDASLKHI RTRKDQVMNE SISILHKKSK ALQQGNNLLA KKVKEDEEQV 180 QFTALEQQNR NTSSSDAR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-21 | 1 | 87 | 1 | 87 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678363687 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011086917.1 | 7e-92 | truncated transcription factor CAULIFLOWER A | ||||
Refseq | XP_011086918.1 | 7e-92 | truncated transcription factor CAULIFLOWER A | ||||
Swissprot | Q42429 | 2e-85 | AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog | ||||
TrEMBL | A0A2G9H572 | 1e-89 | A0A2G9H572_9LAMI; MADS box transcription factor | ||||
STRING | Solyc06g069430.2.1 | 8e-85 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA499 | 23 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 3e-75 | AGAMOUS-like 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|