PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678360633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 616aa    MW: 69341.2 Da    PI: 6.9242
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678360633genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS394.41.2e-1202406132373
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 +lL++c e++  ++ ++++++Larl elasp+g ++++Rlaay+te+La +++r+++ +++  + +  +   ++++ a l+l+++++P++kf h+t N+
  678360633 240 LSLLVTCIEHIGLRNIAAISHCLARLGELASPRGgSAVHRLAAYYTEGLALHVTRKWPLIFEVAARRVFD-PAEDDASAGLRLLNQITPVVKFIHFTSNE 338
                689******************************9899************************988777776.46777888899****************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                 +l+a+e+++r+HiiDf+++qGlQWp+L+q+LasR+++p ++RiTgvg+    sk+el etge L+ fAe+l++pfef+++++++led++l++L++k+ E
  678360633 339 ILLRAFEKKDRIHIIDFGVKQGLQWPSLFQSLASRKGPPTHIRITGVGE----SKQELLETGELLSGFAEALNLPFEFHPVAVSQLEDVRLWMLHIKESE 434
                *************************************************....9********************************************** PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                +laVn+++qlh++++++ + + +  ++L+l++s++++ v+++eqea+hn+  +  r++++l+yysa+fd ++ +lp +se rik+E+   g ei+n++ac
  678360633 435 TLAVNCIFQLHKMVNDRIQERRKLLDFLDLIRSTNAEAVIIAEQEAEHNEMGLDSRVANSLQYYSAIFDFIDCSLPLASEVRIKIEQL-YGCEIRNIIAC 533
                **************************************************************************************99.9********** PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveee......sgslvlgWkdrpLvsvSaW 373
                eg++r+erhe++e+Wr+++e+aGF+++ +++++ +qak++l++++ ++ ++ve++       + l+l W+d+pL+s+SaW
  678360633 534 EGEDRIERHEKFEHWRHWMEQAGFRSMGIRDREHSQAKMILKMYPhQEKFKVEKQeildtgTAHLTLSWMDQPLYSISAW 613
                *********************************************9999****8878887788899************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.591213587IPR005202Transcription factor GRAS
PfamPF035144.2E-118240613IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MLVGCSSTVL SPRHRLKGEA SAQFQGCHIP VMSTQRLDLP CSFTRKDVSS ITESGRPVGV  60
SVEKNVDKKA SSMPLMQQQP QNIKLLPVVS RTKKNQKNEH AFWEQSSSIR KRQVEEICNE  120
EESCPKRVNR QTFGDDGPNF PVSYPCLPLS PLSNFIWTHP FVTGFTDLGA GEDTIVKIKE  180
TTSRSSSSTT SSGSKGLIFE LDHGQGNVLS SGKGTNKIAL AEQESHGGKR CMEDDCIELL  240
SLLVTCIEHI GLRNIAAISH CLARLGELAS PRGGSAVHRL AAYYTEGLAL HVTRKWPLIF  300
EVAARRVFDP AEDDASAGLR LLNQITPVVK FIHFTSNEIL LRAFEKKDRI HIIDFGVKQG  360
LQWPSLFQSL ASRKGPPTHI RITGVGESKQ ELLETGELLS GFAEALNLPF EFHPVAVSQL  420
EDVRLWMLHI KESETLAVNC IFQLHKMVND RIQERRKLLD FLDLIRSTNA EAVIIAEQEA  480
EHNEMGLDSR VANSLQYYSA IFDFIDCSLP LASEVRIKIE QLYGCEIRNI IACEGEDRIE  540
RHEKFEHWRH WMEQAGFRSM GIRDREHSQA KMILKMYPHQ EKFKVEKQEI LDTGTAHLTL  600
SWMDQPLYSI SAWSSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-5924661426379Protein SCARECROW
5b3h_A4e-5924661425378Protein SCARECROW
5b3h_D4e-5924661425378Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678360633
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072178.10.0scarecrow-like protein 28
TrEMBLA0A2G9H0900.0A0A2G9H090_9LAMI; Uncharacterized protein
STRINGEOY246320.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55682434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-162GRAS family protein