PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678352956
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family BES1
Protein Properties Length: 126aa    MW: 14616.9 Da    PI: 10.0481
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678352956genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822101.91.2e-3139107876
     DUF822   8 twkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 
                +++Er  nk RE rRR +a  i+aGLRa+Gnyklpk aD n+ l ALc+eAGw ve DG+++rk+ k l
  678352956  39 SERERLMNKNREWRRRSVAHNIFAGLRAHGNYKLPKNADSNDLLMALCEEAGWHVEGDGEVWRKSGKVL 107
                6789999*********************************************************98866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.7E-2838108IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MEGREECLLR GCIKGSKGPW LVRRRTRDGG IMIKYRFLSE RERLMNKNRE WRRRSVAHNI  60
FAGLRAHGNY KLPKNADSND LLMALCEEAG WHVEGDGEVW RKSGKVLGMK DDDLKAIYEP  120
DTTLKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A2e-1255107391443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B2e-1255107391443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C2e-1255107391443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D2e-1255107391443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678352956
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017976358.12e-46PREDICTED: protein BZR1 homolog 3
TrEMBLA0A2G9GG181e-46A0A2G9GG18_9LAMI; Uncharacterized protein
STRINGEOY070879e-46(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62042130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.39e-16BES1 family protein