PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678352956 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 126aa MW: 14616.9 Da PI: 10.0481 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 101.9 | 1.2e-31 | 39 | 107 | 8 | 76 |
DUF822 8 twkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 +++Er nk RE rRR +a i+aGLRa+Gnyklpk aD n+ l ALc+eAGw ve DG+++rk+ k l 678352956 39 SERERLMNKNREWRRRSVAHNIFAGLRAHGNYKLPKNADSNDLLMALCEEAGWHVEGDGEVWRKSGKVL 107 6789999*********************************************************98866 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 2.7E-28 | 38 | 108 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MEGREECLLR GCIKGSKGPW LVRRRTRDGG IMIKYRFLSE RERLMNKNRE WRRRSVAHNI 60 FAGLRAHGNY KLPKNADSND LLMALCEEAG WHVEGDGEVW RKSGKVLGMK DDDLKAIYEP 120 DTTLKL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 2e-12 | 55 | 107 | 391 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 2e-12 | 55 | 107 | 391 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 2e-12 | 55 | 107 | 391 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 2e-12 | 55 | 107 | 391 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678352956 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017976358.1 | 2e-46 | PREDICTED: protein BZR1 homolog 3 | ||||
TrEMBL | A0A2G9GG18 | 1e-46 | A0A2G9GG18_9LAMI; Uncharacterized protein | ||||
STRING | EOY07087 | 9e-46 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6204 | 21 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G19350.3 | 9e-16 | BES1 family protein |