PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678342640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family BES1
Protein Properties Length: 335aa    MW: 35790.9 Da    PI: 7.7817
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678342640genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822194.24.5e-60211611145
     DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslks 100
                ++++r p+wkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp+e+++  g  a +sp ss+ +s k+
  678342640  21 TSGTRLPSWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWIVEEDGTTYRKGCKPMENTDFSGGLAVVSPGSSYRLSSKT 120
                5899*******************************************************************************************55444 PP

     DUF822 101 salaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                s  +s ++s+ asp ss++  +     +s+a+++sl+p+l++ls+
  678342640 121 SFNPSSASSSFASPVSSQYTTN----VNSSADPNSLIPWLKNLSS 161
                4444444444444444444333....334455599******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.8E-6023160IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MATNAALKTP TWCSGNGLEM TSGTRLPSWK ERENNKRRER RRRAIAAKIF AGLRMYGNYK  60
LPKHCDNNEV LKALCNEAGW IVEEDGTTYR KGCKPMENTD FSGGLAVVSP GSSYRLSSKT  120
SFNPSSASSS FASPVSSQYT TNVNSSADPN SLIPWLKNLS SGSLPVSSKH PHHPYIPGGS  180
ISAPVTPPLS PPSAGTPPLH ANWDDPTSGS GWCSQRFPFF PSSTPQSPGL QTPQDGPSSP  240
MFSLVSANPF GLRDALSNGG SRMWTPGQSG TCSPAVPPGA DQTSDVPMME AVAPEFAFGS  300
NAKGLVKPWE GERIHDDECA PDDLELTLGN PSTRY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A2e-242596372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B2e-242596372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C2e-242596372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D2e-242596372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678342640
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101448.11e-151BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-109BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A2G9HVA01e-148A0A2G9HVA0_9LAMI; Uncharacterized protein
STRINGMigut.M00997.1.p1e-140(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19842464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.12e-88BES1/BZR1 homolog 4