PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678330189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 844aa    MW: 94794.2 Da    PI: 6.7761
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678330189genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.89.7e-1114728412374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +lL+ cA+av++++++ a+ +L +++++++p+gd mqR+a+yf+ +L+ar+a+ ++++y++l   + s    ++ l+a++++  ++P  k s++  Nq+
  678330189 472 STLLTLCAQAVAAENTRSANDYLRQIRQHSTPAGDGMQRVAHYFADGLEARMAGAGTQIYNTLINMPIS---AADLLKAYHIYLAACPHRKTSNFFSNQT 568
                57899**********************************************************999998...89************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                Il+ +e+   +Hi+Df+  +G+QWp++l++L+ Rp+gpps+R T+++ p +g   +++++etg+rLa++A+++++pfefn  +a+++e+++l+++++++g
  678330189 569 ILNVAEKVGSLHIVDFGTLYGFQWPSFLHKLSLRPGGPPSVRFTAIDFPCPGfrPSQRIQETGRRLASYAKKFNIPFEFNG-LAQNWEAITLDDIKMRKG 667
                *************************************************99999***************************.6***************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                E+l+Vn+ ++l +lldesv  + +rd vLkl+++++P ++v+  ++  hn + Fl+rf eal +ys++fd+l+a ++r+ +er+ +Er+++gre++nv+a
  678330189 668 EVLVVNCLYRLRYLLDESVVPDCPRDIVLKLIRKMNPALFVLGIRNGGHNLPFFLTRFREALFHYSSIFDALDAVISRDRHERMLLERVVFGREAMNVIA 767
                ********************999***************************************************************************** PP

       GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                cegaer er et+++W++rl +aG++ +pl+ +++++a+  ++ +++d + ++++  +l++gWk+r  +++S+Wr
  678330189 768 CEGAERLERPETYKQWHARLARAGLEVLPLNREIMATARNKVKLYHKD-FVIDDDGYWLLQGWKGRISYALSSWR 841
                **********************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.544445822IPR005202Transcription factor GRAS
PfamPF035143.4E-108472841IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 844 aa     Download sequence    Send to blast
MNENRNDAKP LACVSELDDF GHPVPQGFPL LRNLRVDDGH AGTSYFNSTS SKPSVGQQVQ  60
SSRGDHSQDP GYSVNVLKYL SRHLLEEDVD DKIWHSRTSA DANAASRKLN FDPQVQSSRN  120
DRPQNIDSCD DVLNYMRRFL LEDDVEEKGG NPGAANAVSN KMNSFGSNIT PSVKKDFIDD  180
DIKYMHHHRL KDNVGKKASW MRNPADEPRD MISEVGSCIK HEDIDFSDDV LKYINHILLE  240
EGVEEKTCTF QESEALQATE KSLYEAMWGQ YPNSTHSVYG DSSLHGSDDR QEGTSLSSQS  300
YSQSSNSSGL GHASVDGNAS SPASSFELVQ VHSGRHAVVQ LNEGTILSDG KLVVCLSDGE  360
ESPDRRVMES GIGTQEFSNA STGKRHPHAD DVPGLQEGRS SKQFALHRES SIGDDVFDRV  420
LVFRQEKEES AIREEINKAF NATMQEDQSK DIKGRKRGKK KREAKKNEAD LSTLLTLCAQ  480
AVAAENTRSA NDYLRQIRQH STPAGDGMQR VAHYFADGLE ARMAGAGTQI YNTLINMPIS  540
AADLLKAYHI YLAACPHRKT SNFFSNQTIL NVAEKVGSLH IVDFGTLYGF QWPSFLHKLS  600
LRPGGPPSVR FTAIDFPCPG FRPSQRIQET GRRLASYAKK FNIPFEFNGL AQNWEAITLD  660
DIKMRKGEVL VVNCLYRLRY LLDESVVPDC PRDIVLKLIR KMNPALFVLG IRNGGHNLPF  720
FLTRFREALF HYSSIFDALD AVISRDRHER MLLERVVFGR EAMNVIACEG AERLERPETY  780
KQWHARLARA GLEVLPLNRE IMATARNKVK LYHKDFVIDD DGYWLLQGWK GRISYALSSW  840
RPAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-504588421380Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678330189
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077208.10.0scarecrow-like protein 14
RefseqXP_020549007.10.0scarecrow-like protein 14
RefseqXP_020549008.10.0scarecrow-like protein 14
TrEMBLS8DQR70.0S8DQR7_9LAMI; Uncharacterized protein
STRINGMigut.F00778.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-169GRAS family protein