PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678321253
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 503aa    MW: 55827.9 Da    PI: 8.3608
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678321253genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.64e-1061284941374
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn......sseelaalklfsevsPilkfs 94 
                lv+lLl+cAe+++ ++ + a+++L ++ el+sp g+++qR+ ayf  AL++r    +  + k+lpp++t++ +       ++ laal++++ ++P++kfs
  678321253 128 LVQLLLRCAECLAVDNVSDASRILPEILELSSPFGSSVQRVGAYFGDALSSRAIA-SYIIGKSLPPNPTPTPRslwkihYQKLLAALQTYNSITPMIKFS 226
                689*************************************************998.678889998888887773455544455555566*********** PP

       GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                h+taNqaI +av+g+++vH+iD+di+qGlQWp ++q LasRp++  slRiTg+g+    s++ l++tg rLa+fA++l++pf+f+++  k  +  e+++L
  678321253 227 HFTANQAIHQAVDGADHVHVIDLDIMQGLQWPGFFQILASRPRKLKSLRITGLGP----SADLLNSTGLRLAEFAATLKIPFHFHAVEGKIGNIEEIDQL 322
                *******************************************************....9**************************76665666699*** PP

       GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve..qeadh.nsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                ++++gE+++V++++  hrl+d ++s       + +++ks++P+++++ve  q+++h +++sFl rf+ al+yysalfd+l  ++p+es er++vE++l+g
  678321253 323 KIRNGETVIVHWMH--HRLYDITGSNLG----FCRFLKSIKPRLITIVErtQDLSHgGGGSFLGRFVGALRYYSALFDALGDGFPPESIERHTVEQQLFG 416
                **************..9***88888888....*****************44467788889**************************************** PP

       GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 ei+n +a + +e      ++e W + +   GF++v+l+ +aa+qa+lll +++++gy++ ee+g+l +gWkd pL+++SaW+
  678321253 417 CEIRNTLAVKSRE-----GEVEMWGKEMAGLGFRQVSLGGNAAAQASLLLGMIPWRGYTLVEENGWLKMGWKDSPLLTASAWQ 494
                *********9999.....7799************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.921102474IPR005202Transcription factor GRAS
PfamPF035141.4E-103128494IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MYSSCCCVYT AWVILVSAVA GEHVFHHRHH LRERSSSCLC HFLPFSQKTK LTRSFFLAFY  60
FPSFLSTCNR RNANASSFSG RRSAVSMAST GKRPWVEVED DDISGGEPIK RNRAAQHERD  120
PDEAGLCLVQ LLLRCAECLA VDNVSDASRI LPEILELSSP FGSSVQRVGA YFGDALSSRA  180
IASYIIGKSL PPNPTPTPRS LWKIHYQKLL AALQTYNSIT PMIKFSHFTA NQAIHQAVDG  240
ADHVHVIDLD IMQGLQWPGF FQILASRPRK LKSLRITGLG PSADLLNSTG LRLAEFAATL  300
KIPFHFHAVE GKIGNIEEID QLKIRNGETV IVHWMHHRLY DITGSNLGFC RFLKSIKPRL  360
ITIVERTQDL SHGGGGSFLG RFVGALRYYS ALFDALGDGF PPESIERHTV EQQLFGCEIR  420
NTLAVKSREG EVEMWGKEMA GLGFRQVSLG GNAAAQASLL LGMIPWRGYT LVEENGWLKM  480
GWKDSPLLTA SAWQTPDSPP SLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-1271074985382Protein SCARECROW
5b3h_A1e-1271074984381Protein SCARECROW
5b3h_D1e-1271074984381Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678321253
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100390.10.0scarecrow-like protein 23
SwissprotQ9FHZ11e-154SCL23_ARATH; Scarecrow-like protein 23
TrEMBLA0A2Z7A7201e-173A0A2Z7A720_9LAMI; Uncharacterized protein
STRINGEOX931731e-163(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA107452126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-145GRAS family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yoon EK, et al.
    Conservation and Diversification of the SHR-SCR-SCL23 Regulatory Network in the Development of the Functional Endodermis in Arabidopsis Shoots.
    Mol Plant, 2016. 9(8): p. 1197-1209
    [PMID:27353361]