PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678319964 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 134aa MW: 14761.8 Da PI: 10.8465 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.5 | 3.5e-19 | 60 | 107 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l d+++++Ggg+W++ +++ g++R++k+c++rw +yl 678319964 60 KGPWTEEEDRKLMDYIRRYGGGNWSSLPAKAGLRRCGKSCRLRWTNYL 107 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.469 | 55 | 111 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.0E-24 | 57 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.2E-14 | 59 | 109 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-17 | 60 | 107 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.05E-22 | 61 | 134 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.28E-12 | 62 | 107 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.1E-7 | 111 | 134 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MTSISGGLGP TFSAFSSNQP ACLRSISTRA AHDTAQPAVW SSFNASAMGI QSNNALGLKK 60 GPWTEEEDRK LMDYIRRYGG GNWSSLPAKA GLRRCGKSCR LRWTNYLRPD ISRGKFSVQE 120 EKTILRLHAL LGNK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-17 | 58 | 134 | 5 | 80 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678319964 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021976274.1 | 3e-40 | transcription factor MYB16-like | ||||
Swissprot | Q9LDR8 | 2e-39 | MY102_ARATH; Transcription factor MYB102 | ||||
Swissprot | Q9LXF1 | 1e-39 | MYB16_ARATH; Transcription factor MYB16 | ||||
TrEMBL | A0A2U1LDH5 | 4e-39 | A0A2U1LDH5_ARTAN; Homeodomain-like protein | ||||
TrEMBL | A0A2U1NDQ6 | 4e-39 | A0A2U1NDQ6_ARTAN; Homeodomain-like protein | ||||
TrEMBL | S8CBS1 | 4e-40 | S8CBS1_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Lus10030442 | 3e-39 | (Linum usitatissimum) | ||||
STRING | Traes_2AL_839C94CA3.1 | 4e-39 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15310.1 | 6e-42 | myb domain protein 16 |