PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678311541 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 150aa MW: 16485.5 Da PI: 8.9828 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 136.1 | 1.3e-42 | 14 | 112 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 +CaaCk+lr+kC + C++apyfp ++p+kf nvh++FGasn++kll+++++++reda++sl++eAear++dPvyG+vg i+ lq+q+ ql++el+++++ 678311541 14 PCAACKYLRKKCLPRCTFAPYFPPQDPNKFLNVHRVFGASNITKLLNEIDPTQREDAVNSLAFEAEARVKDPVYGCVGAISILQNQVIQLQKELDATNA 112 7*********************************************************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.766 | 13 | 114 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.8E-42 | 14 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MSSSASRSLN SNPPCAACKY LRKKCLPRCT FAPYFPPQDP NKFLNVHRVF GASNITKLLN 60 EIDPTQREDA VNSLAFEAEA RVKDPVYGCV GAISILQNQV IQLQKELDAT NADIVRYSGG 120 LRSGYQEQQR RSTAAPAAAY SWNSGENGSR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-59 | 4 | 124 | 1 | 121 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-59 | 4 | 124 | 1 | 121 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678311541 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018625400.1 | 2e-64 | PREDICTED: LOB domain-containing protein 25-like isoform X2 | ||||
Swissprot | Q8L8Q3 | 1e-58 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
Swissprot | Q9FML4 | 3e-58 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A1S3C8P8 | 2e-62 | A0A1S3C8P8_CUCME; LOB domain-containing protein 25 | ||||
STRING | XP_008458801.1 | 3e-63 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27650.1 | 2e-60 | LOB domain-containing protein 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|