PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678309759
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 715aa    MW: 78092.2 Da    PI: 6.2698
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678309759genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS312.11.2e-953517083374
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal..ppsetseknsseelaalklfsevsPilkfshltaNq 100
                +lL+++Ae v++g++ la+ +Larl+++ sp+g p+qR+a+y +eAL+  l+++++++ + l  ++++t++ + ++++ a+k+fse+sP+l f++lt Nq
  678309759 351 DLLYQAAELVQTGNFVLAHGILARLNHQLSPNGIPFQRAAFYSKEALQLLLQSTSNNVDDPLmtTVRKTPPFSIISRIGAYKAFSEISPLLHFQNLTSNQ 450
                79***************************************************99999999854555666667*************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                aIle++eg +r+HiiDfdi++G+QW++L+q+La R++ + s++iT+++sp  +++ el  ++e+L++fA+ ++++fef++    +++  +l++ ++++  
  678309759 451 AILESLEGFNRIHIIDFDIGYGGQWASLIQELALRSGRSTSMKITAIVSPLINNHLELGLIRENLTQFANDVNISFEFEAT---SID--SLSSGSWSEAG 545
                *************************************************9999**************************94...444..44666789999 PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvva 299
                a+aVnl +     +  + s++     +L+lvk+l+P++vv ++q +d+++ sF +++++al+  ++++ds+ +a+  ++ ++ +k+E +l++++++ +v+
  678309759 546 AVAVNLPVGSVANY--QFSMPL----ILRLVKQLRPRIVVSTDQGCDRTDLSFPDHLIHALHSLTTVLDSIyAAN--PHLDTLQKIESFLIQPALERIVT 637
                99**9999666555..566665....*********************************************5555..5668999***************9 PP

       GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 + ++     ++ ++Wr++l ++GF+pv++s+ a++qa++++++++++g++ve+++ slvl+W++++L++vSaWr
  678309759 638 SRFRS----LKKTQHWRSMLLSSGFSPVAFSNLAESQAECVINRTPVQGFQVEKRQSSLVLCWRGQELTAVSAWR 708
                88777....99999************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.564323688IPR005202Transcription factor GRAS
PfamPF035144.3E-93351708IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MKGMPLPLDF EGKEVLDLDL IVKNRTFFSD SGGELLQLSN CSGFGEPTSV LESASTPSRP  60
TSSSTLSSSL GEGGGSTVAG SASTDTAAKW QRGSTATSSN AVGKALIASP RSMEFEGVGC  120
GGTEKFTMED WESVLSASTA VSPNHEESIL RWIMADAEDA ALVMNKAPQI GAGGVFPAAE  180
FDFSSGFAAV HQTPTLPVFL DNDRPSSQRI SSLSPYPDQP TCFKFSPISQ GILHPCPETK  240
PSILNSHILI NQQSQNPSFF FPVPSSVQQE QSIFVHPPAK RQNFGRFADV GLDSAGQISK  300
GPFMDSGQHT VFLQQQFSPQ LQFLPSCQHQ WQKEKPKLTV CDDFGQQATS DLLYQAAELV  360
QTGNFVLAHG ILARLNHQLS PNGIPFQRAA FYSKEALQLL LQSTSNNVDD PLMTTVRKTP  420
PFSIISRIGA YKAFSEISPL LHFQNLTSNQ AILESLEGFN RIHIIDFDIG YGGQWASLIQ  480
ELALRSGRST SMKITAIVSP LINNHLELGL IRENLTQFAN DVNISFEFEA TSIDSLSSGS  540
WSEAGAVAVN LPVGSVANYQ FSMPLILRLV KQLRPRIVVS TDQGCDRTDL SFPDHLIHAL  600
HSLTTVLDSI YAANPHLDTL QKIESFLIQP ALERIVTSRF RSLKKTQHWR SMLLSSGFSP  660
VAFSNLAESQ AECVINRTPV QGFQVEKRQS SLVLCWRGQE LTAVSAWRCR FRSSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-2735571025381Protein SCARECROW
5b3h_A3e-2735571024380Protein SCARECROW
5b3h_D3e-2735571024380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678309759
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090295.10.0scarecrow-like protein 6
SwissprotO813161e-118SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A2G9GWL50.0A0A2G9GWL5_9LAMI; Uncharacterized protein
STRINGMigut.B01597.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-120GRAS family protein
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]