PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678301307
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MYB
Protein Properties Length: 470aa    MW: 51839.3 Da    PI: 4.6084
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678301307genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.1e-1858105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT  Ede l+d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
        678301307  58 KGPWTSREDEVLIDYVQKHGEGNWNAVQKHTGLSRCGKSCRLRWANHL 105
                      79******************************************9986 PP

2Myb_DNA-binding46.39.8e-15111154146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++ eE+ +++++++++G++ W++ a +++ gRt++++k++w++
        678301307 111 KGPFSSEEERQIIELHAKMGNK-WARMAVELP-GRTDNEIKNFWNT 154
                      79********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.36853105IPR017930Myb domain
SuperFamilySSF466892.36E-3055152IPR009057Homeodomain-like
SMARTSM007172.9E-1557107IPR001005SANT/Myb domain
PfamPF002496.8E-1658105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2459112IPR009057Homeodomain-like
CDDcd001676.42E-1260105No hitNo description
PROSITE profilePS5129423.459106160IPR017930Myb domain
SMARTSM007173.0E-15110158IPR001005SANT/Myb domain
PfamPF002491.7E-13111154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-24113159IPR009057Homeodomain-like
CDDcd001674.89E-11113154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MFEFIPFHAV TDLGPYDQEM SLTSESDEAM LPHNGIGSPP ADDDNSGGNA GSNSSMKKGP  60
WTSREDEVLI DYVQKHGEGN WNAVQKHTGL SRCGKSCRLR WANHLRPDLK KGPFSSEEER  120
QIIELHAKMG NKWARMAVEL PGRTDNEIKN FWNTRIKRRQ RAGLPIYPVD ICPQLKSENL  180
QRDEIDSYSM GEVRPPDFAP VEDFDIPPIG FKSPSQPLYS PTHDISTVSM PEIPSSLILA  240
QDPQPSYSDR SLCSALHSSK PPCGSEFLFA DYNTPIVSSL TGANHLNGDG SLQIARSLGF  300
PSFYEHNSVS DQAVSADLFP GNHTILTSTS ELPSLQNQAG GWGVLPPSFP PPVVDDILIQ  360
PTEAENTCMF SPRNSGLLDN VLYESEIKKF NANTFLYPET SHGPAMAPYA VNDSTQDPHE  420
NMWGYDDQFS PLGHSSSSVF CDGSPFSANS FEELQSANGF PGDHSRTYYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-325315922127MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678301307
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090254.11e-151transcription factor GAMYB-like
TrEMBLA0A068UQ741e-142A0A068UQ74_COFCA; Uncharacterized protein
STRINGXP_009786742.11e-127(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.19e-72myb domain protein 33