PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678296357 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 184aa MW: 20281.9 Da PI: 10.4969 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.5 | 3.6e-14 | 72 | 116 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++ G+g+W+ I+r k+Rt+ q+ s+ qky 678296357 72 PWTEEEHRLFLVGLEKVGKGDWRGISRNYVKTRTPTQVASHAQKY 116 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.446 | 65 | 121 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.01E-17 | 66 | 120 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 9.3E-17 | 68 | 119 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.6E-10 | 69 | 119 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-11 | 71 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.24E-10 | 72 | 117 | No hit | No description |
Pfam | PF00249 | 1.8E-11 | 72 | 116 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MSEEDGFVEI MLFGVPVKVD PMRKTVSMSN LMEYEPGSIP KPAAEDSSGY ASVDDALPLP 60 CAVSRSRKRG TPWTEEEHRL FLVGLEKVGK GDWRGISRNY VKTRTPTQVA SHAQKYFLRR 120 TNGSRRPRRR RSSLFDISTE TAASAASSSP ALGLSLSLSS AHHTQMANSF KSRDSNGSSM 180 IRVT |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 124 | 129 | RRPRRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00236 | DAP | Transfer from AT1G74840 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678296357 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011071772.1 | 1e-53 | transcription factor MYB1R1 | ||||
Swissprot | Q2V9B0 | 4e-44 | MY1R1_SOLTU; Transcription factor MYB1R1 | ||||
TrEMBL | A0A4D8YFX1 | 2e-58 | A0A4D8YFX1_SALSN; Uncharacterized protein | ||||
STRING | Migut.D01891.1.p | 8e-49 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2574 | 23 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74840.2 | 1e-45 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|