PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678290680 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 251aa MW: 29234.7 Da PI: 9.2238 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.5 | 1.1e-30 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaevavi+fs++g+ly ++ 678290680 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVAVIVFSNRGRLYQFP 58 79**********************************************97 PP | |||||||
2 | K-box | 86.4 | 5.6e-29 | 85 | 176 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +e ae++qqe +kL+++i++Lq +RhllGe+L+sL++ke++qLe++Le++++kiR++K+e++l++++ l k+ l++en ++r+k++e 678290680 85 PHEIRAEQYQQECKKLRQQIQMLQDANRHLLGEGLGSLNVKEMKQLESRLERGISKIRNRKHEMILAETDGLEKRGVLLEQENAYMRAKIQE 176 6778899**********************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.6E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.786 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.04E-41 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 3.53E-31 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.6E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.8E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.6E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.6E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.6E-23 | 89 | 174 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.902 | 90 | 180 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 251 aa Download sequence Send to blast |
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEVAVIVFSN RGRLYQFPLD 60 SRSVKETIER YKIKKREDQE TPNVPHEIRA EQYQQECKKL RQQIQMLQDA NRHLLGEGLG 120 SLNVKEMKQL ESRLERGISK IRNRKHEMIL AETDGLEKRG VLLEQENAYM RAKIQENERL 180 QELSMMPPGA ELSMMPGAGP ELNMMMPNGQ ELALQAYYTR HLLQFNVMEG VSSEADYIVQ 240 NKKDLRLGYD Y |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-19 | 1 | 90 | 1 | 80 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678290680 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012855039.1 | 1e-101 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 | ||||
Swissprot | F6I457 | 1e-82 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A2G9H1Q5 | 1e-100 | A0A2G9H1Q5_9LAMI; MADS box transcription factor | ||||
STRING | Migut.C01334.1.p | 4e-97 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-76 | MIKC_MADS family protein |