PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_35152-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 355aa    MW: 38989 Da    PI: 7.6368
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_35152-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.14.8e-55361631129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdee++++yL++k+ ++++    vi evd++k+ePw+Lp k+k +ekewyfF+++d+ky+tg+r+nrat+sgyWkatgkdke+++
  TRIUR3_35152-P1  36 LPPGFRFHPTDEEIISHYLTPKALDHRFCS-GVIGEVDLNKCEPWHLPGKAKMGEKEWYFFCHKDRKYPTGTRTNRATESGYWKATGKDKEIFR 128
                      79*************************888.89***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +g lvg+kktLvfy grap+gekt Wvmhe+rle
  TRIUR3_35152-P1 129 GRGLLVGMKKTLVFYLGRAPRGEKTGWVMHEFRLE 163
                      9*******************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6230186IPR003441NAC domain
PROSITE profilePS5100557.11836186IPR003441NAC domain
PfamPF023651.1E-2837162IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000975Molecular Functionregulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MAGDGGVYIV TVMKASSSVG DKPRRGSRAA PAGWALPPGF RFHPTDEEII SHYLTPKALD  60
HRFCSGVIGE VDLNKCEPWH LPGKAKMGEK EWYFFCHKDR KYPTGTRTNR ATESGYWKAT  120
GKDKEIFRGR GLLVGMKKTL VFYLGRAPRG EKTGWVMHEF RLEGKLPHPL PRSAKDEWAV  180
SKVFNKELTA TNGAMAAADA GIERVSSFGF ITDFLDSGEL PPLMDPPLGG DVDQVTDFKS  240
TSAYATGAHS GHQVKMEQHM PQQPPHMMYS SPYFSLPAAN SGDMSPAIRR YCKAEQVSGQ  300
TSALSPSRET GLSTDPNAAG CAEISSAATP SSQNQEFLDQ FDEYPALNLA DIWKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-513519019172NAC domain-containing protein 19
3swm_B3e-513519019172NAC domain-containing protein 19
3swm_C3e-513519019172NAC domain-containing protein 19
3swm_D3e-513519019172NAC domain-containing protein 19
3swp_A3e-513519019172NAC domain-containing protein 19
3swp_B3e-513519019172NAC domain-containing protein 19
3swp_C3e-513519019172NAC domain-containing protein 19
3swp_D3e-513519019172NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that acts as positive regulator of leaf senescence. Activates NYC1, SGR1, SGR2 and PAO, which are genes involved in chlorophyll catabolic processes. Activates senescence-associated genes, such as RNS1, SAG12 and SAG13. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3762970.0AK376297.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3120C21.
GenBankFR8197630.0FR819763.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC013 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020162549.10.0NAC domain-containing protein 92-like
SwissprotQ9SQQ65e-90NAC46_ARATH; NAC domain-containing protein 46
TrEMBLT1NW970.0T1NW97_TRIUA; Uncharacterized protein
STRINGTRIUR3_35152-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04060.15e-84NAC domain containing protein 46
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Oda-Yamamizo C, et al.
    Corrigendum: The NAC transcription factor ANAC046 is a positive regulator of chlorophyll degradation and senescence in Arabidopsis leaves.
    Sci Rep, 2016. 6: p. 35125
    [PMID:27759025]
  4. O'Shea C, et al.
    Structures and Short Linear Motif of Disordered Transcription Factor Regions Provide Clues to the Interactome of the Cellular Hub Protein Radical-induced Cell Death1.
    J. Biol. Chem., 2017. 292(2): p. 512-527
    [PMID:27881680]