PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRIUR3_35146-P1

Organism

Triticum urartu

Taxonomic ID

4572

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 126aa MW: 13890.8 Da PI: 11.3905

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRIUR3_35146-P1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.4	5e-16	22	66	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky TRIUR3_35146-P1 22 PWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKY 66 8*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	20.245	15	71	IPR017930	Myb domain
SuperFamily	SSF46689	8.61E-19	16	71	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.6E-19	18	70	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	4.7E-12	19	65	IPR009057	Homeodomain-like
SMART	SM00717	1.5E-11	19	69	IPR001005	SANT/Myb domain
CDD	cd00167	5.16E-11	22	67	No hit	No description
Pfam	PF00249	5.1E-13	22	66	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
MGHGYLSDGL MGRAQERKKG VPWTEDEHRR FLAGLEKLGK GDWRGISRHF VTTRTPTQVA 60 SHAQKYFLRQ AGLAQKKRRS SLFDVAPDLE LKISSTAARK TDQQAGAAAG SSPSPRTPFL 120 GTIRVT

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00565	DAP	Transfer from AT5G56840	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	-	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ624399	1e-141	KJ624399.1 Triticum aestivum MYBSM151 mRNA, complete cds.
GenBank	KP330479	1e-141	KP330479.1 Triticum aestivum MYB transcription factor SM151 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020153631.1	7e-57	uncharacterized protein LOC109738954
Swissprot	Q7XC57	4e-39	MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBL	M7Z095	1e-86	M7Z095_TRIUA; Transcription factor MYB1R1
STRING	TRIUR3_35146-P1	2e-87	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4231	38	73

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G56840.1	1e-40	MYB_related family protein

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Su CF, et al. A novel MYBS3-dependent pathway confers cold tolerance in rice. Plant Physiol., 2010. 153(1): p. 145-58 [PMID:20130099]