PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRIUR3_34699-P1

Organism

Triticum urartu

Taxonomic ID

4572

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 85aa MW: 9731.03 Da PI: 8.5131

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRIUR3_34699-P1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	61.9	1.3e-19	20	67	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd llv++++ +G g+W++ ar g++Rt+k+c++rw++yl TRIUR3_34699-P1 20 RGPWTVEEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 67 89*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	23.267	15	71	IPR017930	Myb domain
SuperFamily	SSF46689	1.96E-19	17	78	IPR009057	Homeodomain-like
SMART	SM00717	2.1E-15	19	69	IPR001005	SANT/Myb domain
Pfam	PF00249	9.6E-18	20	67	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.1E-23	21	84	IPR009057	Homeodomain-like
CDD	cd00167	1.86E-12	22	67	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MAHERDSSSE EEVMAGDLRR GPWTVEEDIL LVNYIAAHGE GRWNSLARSA GLKRTGKSCR 60 LRWLNYLRPD LRRGSITPQE QLLIP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JF951909	1e-134	JF951909.1 Triticum aestivum clone TaMYB26 R2R3-MYB protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003561685.1	3e-53	transcription factor MYB2
Swissprot	Q10MB4	4e-52	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	A0A453I7K5	6e-56	A0A453I7K5_AEGTS; Uncharacterized protein
STRING	TRIUR3_34699-P1	6e-56	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP198	38	330

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G40350.1	3e-39	myb domain protein 24

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]