PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_34593-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family TALE
Protein Properties Length: 240aa    MW: 26945.4 Da    PI: 7.2197
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_34593-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-091922252255
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  TRIUR3_34593-P1 192 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 225
                      59*****************************885 PP

2ELK33.68.8e-12145166122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK++Ll+KYsg+L+ L++EF+
  TRIUR3_34593-P1 145 ELKEMLLKKYSGCLSRLRSEFL 166
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.5E-17143IPR005540KNOX1
PfamPF037901.6E-20139IPR005540KNOX1
SMARTSM012567.5E-2549100IPR005541KNOX2
PfamPF037914.1E-235399IPR005541KNOX2
SMARTSM011883.6E-6145166IPR005539ELK domain
PROSITE profilePS5121310.423145165IPR005539ELK domain
PfamPF037891.0E-8145166IPR005539ELK domain
PROSITE profilePS5007112.519165228IPR001356Homeobox domain
SuperFamilySSF466898.98E-20167234IPR009057Homeodomain-like
SMARTSM003893.3E-14167232IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.3E-27170230IPR009057Homeodomain-like
CDDcd000861.26E-12177229No hitNo description
PfamPF059203.6E-17185224IPR008422Homeobox KN domain
PROSITE patternPS000270203226IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0010094Biological Processspecification of carpel identity
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MKAQIAGHPR YPSLLSAYIE CRKVGAPPEV AALLEEIGQP ERRSGGAAAA GEIGLDPELD  60
EFMEAYCRLL SRYKEELSRP LDEAASFLTT IRSQLTNLCG GGATATSPHS GSLSTHSIKD  120
EPCSGDADGS DAGMQEHSSR LADHELKEML LKKYSGCLSR LRSEFLKKRK KGKLPKDARL  180
ALMDWWNTHY RWPYPTEEDK VRLAAMTGLD PKQINNWFIN QRKRHWKPSE DMRYDGGEHD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160169LRSEFLKKRK
2166170KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4650421e-178AB465042.1 Triticum aestivum WLG4 mRNA for KN1-type homeobox transcription factor, complete cds.
GenBankAK2486001e-178AK248600.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf126d22, mRNA sequence.
GenBankAK3636151e-178AK363615.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2017F18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020178258.11e-154homeobox protein knotted-1-like 10
SwissprotQ9FP291e-115KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLM7ZE941e-177M7ZE94_TRIUA; Homeobox protein knotted-1-like 1
STRINGTRIUR3_34593-P11e-178(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-76KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Park SH, et al.
    A Ds-insertion mutant of OSH6 (Oryza sativa Homeobox 6) exhibits outgrowth of vestigial leaf-like structures, bracts, in rice.
    Planta, 2007. 227(1): p. 1-12
    [PMID:17624547]