PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_34152-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family TALE
Protein Properties Length: 172aa    MW: 19484.7 Da    PI: 6.2898
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_34152-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.97.2e-081211542154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp+++++++L +++gL+ +q+ +WF N+R +
  TRIUR3_34152-P1 121 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 154
                      569*****************************87 PP

2ELK27.95.3e-107596122
              ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                     ELK +L+++Y+++L+++++E++
  TRIUR3_34152-P1 75 ELKSELKQGYKEKLVDIREEIM 96
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011888.3E-47596IPR005539ELK domain
PROSITE profilePS512139.837595IPR005539ELK domain
PfamPF037892.4E-67596IPR005539ELK domain
PROSITE profilePS5007111.51595158IPR001356Homeobox domain
SuperFamilySSF466894.71E-1697160IPR009057Homeodomain-like
SMARTSM003894.9E-1097162IPR001356Homeobox domain
CDDcd000865.66E-1198159No hitNo description
Gene3DG3DSA:1.10.10.602.3E-24102158IPR009057Homeodomain-like
PfamPF059203.4E-18115154IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MEAVMGCWEL EQSLQSLTGA SPGEGTGATM SDDEDNQVDS EANMFDGNDG SDGMGFGPLI  60
LTEGERSLIE RVRHELKSEL KQGYKEKLVD IREEIMRKRR AGKLPGDTAA TLKAWWQAHS  120
KWPYPTEDDK ARLVQETGLQ LKQINNWFIN QRKRNWHSSN TASSSEKTKK KR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151171RKRNWHSSNTASSSEKTKKKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020195854.11e-124homeobox protein knotted-1-like 2 isoform X2
SwissprotQ0E3C31e-118KNOS2_ORYSJ; Homeobox protein knotted-1-like 2
TrEMBLA0A3B6NN691e-124A0A3B6NN69_WHEAT; Uncharacterized protein
TrEMBLM7YLK91e-124M7YLK9_TRIUA; Homeobox protein knotted-1-like 2
STRINGTraes_6AS_2FB24B03E.11e-125(Triticum aestivum)
STRINGTRIUR3_34152-P11e-125(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-101KNOTTED1-like homeobox gene 3