PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33524-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 783aa    MW: 86208.6 Da    PI: 4.7073
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33524-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.7e-53221501129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l+pGfrFhPtdeelv++yLk+kv g++l++ ++i+evd+ykvePwdLp+  ++++++++wyfFs+ d+k+a+  r+nrat+ gyWk+tgkd+ev
  TRIUR3_33524-P1  22 LAPGFRFHPTDEELVSYYLKRKVLGRPLKV-DAIAEVDLYKVEPWDLPArsRLRSRDSQWYFFSRLDRKHANRARTNRATAGGYWKTTGKDREV 114
                      579***************************.99***************4357888999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       + + ++vg+kktLvf+ grapkge+t+Wvmheyrle
  TRIUR3_33524-P1 115 RH-GARVVGMKKTLVFHAGRAPKGERTNWVMHEYRLE 150
                      **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-6019170IPR003441NAC domain
PROSITE profilePS5100559.27922170IPR003441NAC domain
PfamPF023651.9E-2824149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
MTHPSSSSSS APAAAPDDPT SLAPGFRFHP TDEELVSYYL KRKVLGRPLK VDAIAEVDLY  60
KVEPWDLPAR SRLRSRDSQW YFFSRLDRKH ANRARTNRAT AGGYWKTTGK DREVRHGARV  120
VGMKKTLVFH AGRAPKGERT NWVMHEYRLE GDGAAGIPQD SFVVCRIFQK AGPGPQNGAQ  180
YGAPFVEEEW EADEDDDFGP LPVQRDVFGE HEAPGAMEKG YLQMNDLIQM STCKPQPFLL  240
YVDVRERQLD LLDNSLLRND APVVRVCEEL RLTSKYEIMT HKSHDVIVFT IQDLAGQNEN  300
GSVVLPVSDT SNTSSHSEDV EGNSGDILND PSLCSNFLQY IHPGEQNSPM LVENMLSNAN  360
VGDFLNSSSP NDEFLELKDL ELPLGNDSTI WPSDGWAWKT AFPLDAVNGS NNEVPLITGD  420
QPFQPDELAQ LLQTLQDDSS QLGSTMTDLP HSSITNSVKP EDDSLVYFDA PFDNSMFSDG  480
FRQTNGFLGS PATILSGIET LDDGIPYYDA MDDNLFNDMM CSVQQSAGSS SHVFNGPVLT  540
QEVNNPSYTY SPTQKVVEPN FVVGAASSAR LSEAGGQLNC VVLPDSQAKN GSMGKRFVKM  600
LDSISAPPAF AAEFPGKSLS GVHPNTISVS TEVISIGSLT VASRQGKWSF QKDEDMELVF  660
STGFQPDNRI HCGGCNTVTA VLRGGFCLFF LSAIMLLVSY EVGLCIYGKF EQNSKPWSRR  720
HNPLPCEKLK LDTFYSHRFI AKVDRVGWSN LSDEPMPFGA SLVAFSRMPS MARVAVMGIA  780
ACL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-472117014168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0275740.0HM027574.2 Triticum aestivum NAC transcription factor NTL5 (NTL5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020181541.10.0NAC domain-containing protein 78-like
TrEMBLM7ZYB60.0M7ZYB6_TRIUA; NAC domain-containing protein 78
STRINGTRIUR3_33524-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.15e-75NAC domain containing protein 53