PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33275-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 194aa    MW: 21132.7 Da    PI: 9.7225
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33275-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM93.63.3e-29181452128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                      +pGfrF Pt++el+ +yL+++++g++  ++++vi+ vd+y+++P++L++    +  ++ ++w+fF++r++++ +g  +      ++ +++ ++ 
  TRIUR3_33275-P1  18 TPGFRFYPTEDELLGFYLRHRLAGTTrPHVDRVIPVVDVYSHHPSHLRSmageASVQDAEQWFFFCPRAERELRGGPPGPP---AVFSSSSSSS 108
                      69*********************9995666678**************84345322235669*********99988888774...3466666666 PP

              NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +    +++++g+k+t+vfy+grap+g kt+W m+ey++
  TRIUR3_33275-P1 109 AAAG-NSKVIGVKRTMVFYQGRAPTGAKTTWKMNEYKA 145
                      6666.899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.16E-3214175IPR003441NAC domain
PROSITE profilePS5100534.79217176IPR003441NAC domain
PfamPF023656.8E-1819144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MMTTTSSGGA GGDLLVSTPG FRFYPTEDEL LGFYLRHRLA GTTRPHVDRV IPVVDVYSHH  60
PSHLRSMAGE ASVQDAEQWF FFCPRAEREL RGGPPGPPAV FSSSSSSSAA AGNSKVIGVK  120
RTMVFYQGRA PTGAKTTWKM NEYKAVAADD DTTTGHQTTA PLRLRNEFSV CRLYISTGTL  180
RSFDRRPLNT SGNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-211917417166Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020185458.11e-122NAC domain-containing protein 90-like isoform X1
SwissprotQ9FMR32e-55NAC90_ARATH; NAC domain-containing protein 90
TrEMBLT1NR581e-141T1NR58_TRIUA; Uncharacterized protein
STRINGTRIUR3_33275-P11e-142(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.17e-52NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]