PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33045-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ARF
Protein Properties Length: 956aa    MW: 106945 Da    PI: 6.612
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33045-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.42.3e-2292193199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++   W++++i+r++++r++lt+GW+ Fv+ ++L +gD+v+F   ++
  TRIUR3_33045-P1  92 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELMAKDLHDIPWKFRHIFRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFI--RD 181
                      99*****************************96555544..8************************************************..45 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      ++ +l+++++r+
  TRIUR3_33045-P1 182 EKSQLLLGIRRA 193
                      677789999997 PP

2Auxin_resp123.12e-40218300183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dldpvrW+nS+Wr+L+
  TRIUR3_33045-P1 218 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQ 300
                      79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.22E-4382221IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.3E-4084207IPR015300DNA-binding pseudobarrel domain
CDDcd100171.21E-1891192No hitNo description
PROSITE profilePS5086311.87192194IPR003340B3 DNA binding domain
SMARTSM010191.8E-2192194IPR003340B3 DNA binding domain
PfamPF023622.7E-2092193IPR003340B3 DNA binding domain
PfamPF065073.4E-35218300IPR010525Auxin response factor
PROSITE profilePS5174522.409888956IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 956 aa     Download sequence    Send to blast
MPPVGSLVVY FPQGHSEQVA ASMHKEVDII PNYPSLPSKL ICKLLSLTLH ADSETDEVYA  60
QMTLQPVNKY DRDAMLASEL GLKQNKQPVE FFCKTLTASD TSTHGGFSVP RRAAEKIFPP  120
LDFTMQPPAQ ELMAKDLHDI PWKFRHIFRG QPKRHLLTTG WSVFVSTKRL LAGDSVLFIR  180
DEKSQLLLGI RRATRPQPAL SSSVLSSDSM HIGILAAAAH AAANSSPFTI FYNPRASPSE  240
FVIPLAKYNK ALYTQVSLGM RFRMLFETED SGVRRYMGTI TGIGDLDPVR WKNSHWRNLQ  300
VGWDESTASE RRTRVSIWEI EPVATPFYIC PPPFFRPKLP KQPGMPDDEG EVDSAFKRAM  360
PWLGDDFALK DVQSQLFPGL SLVQWMAMQQ NPQMLPAGAP AVQAPYLNSS AMAMQDGTGT  420
GNDDLMRRFN MQSQNISLPN SQVGSKMDHA AMAQHQQQSH QLQQQQQQQQ EHLQRQQSLP  480
QQQQEHLQRQ QSQPQQQLKT AASMPSMEQH KLREQQPQGG QAVSQAQMLS QIFQPSSSQL  540
QQLGLPKSPT QRPGFPGLPT ASSLQQPALG QAPQVQQAAE YQQALLQSQQ QQLQQLSQPE  600
MQLQLLQKIQ QQNMLSQLNP QHQSQLMQQL SQKNQEYLQQ QILQHQLSGS DAMVQFKQSH  660
QTPSNNITGS LTPQQLARSH SALAESEDPS SSTAPSANRL SPMNSLSRTH QGSRNLTDMT  720
TSPHIDNLLQ EIQSKPDNRN KNDLQSSKET IPVPNRYPVS DQLDASSATS FCLDESPREG  780
FSFPPVCLDS NAQVDPRDNF LIAENVDSLM PDALLSRGMG SGKDICNLPS GQRDHREVDN  840
ELSSAAFSSQ SFGVPDISFK PGCSGDIAVN DGGMPSQGLW NNQTQRMRTF TKVQKRGSVG  900
RSIDITRYTN YDELRHDLAC MFGIQGQLED PYRMDWKLVY VDHENDILLV GDDPWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-151132166388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3742620.0AK374262.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3058N24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021305688.10.0auxin response factor 16 isoform X1
RefseqXP_025812098.10.0auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLM7YTG80.0M7YTG8_TRIUA; Auxin response factor
STRINGTRIUR3_33045-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]