PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_32890-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 328aa    MW: 35996.8 Da    PI: 5.7973
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_32890-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM58.22.8e-181566153
              NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka 53
                     lppGfrFhPtdeel+ +yL++++++ ++++  +i++vdiyk++PwdLp+++  
  TRIUR3_32890-P1 15 LPPGFRFHPTDEELILHYLRNRAAAAPCPV-AIIADVDIYKFDPWDLPSQAVY 66
                     79****************************.88***************54333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-221271IPR003441NAC domain
PROSITE profilePS5100516.4115156IPR003441NAC domain
PfamPF023651.9E-71658IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAMAQGQGQG AATSLPPGFR FHPTDEELIL HYLRNRAAAA PCPVAIIADV DIYKFDPWDL  60
PSQAVYGDCE WPAGTMPESR PAAAPLTTAV NIYKPIKFRN VSMRLDDWVL CRIYKKTGLA  120
SPMVPPLSDY DHIADHDDLS GGGSTFDDAA CSFYAHSSSS SSASRTMITQ QPPHAGGLPT  180
IPSFSELFDD YSLAQILDAE AEHGATHHLA VHPSLNMLLP VGDNAHGVQP SYYAPSSSSP  240
DASGGSAGKR KAASPEESSA KRLNGSCFDA PPQSANSWQG AASKKKKSRR RRRDEEEEGE  300
EEEEEEEEEE ERRKKKRRRR RRREGKEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-2411161168Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311316RRKKKR
2311322RRKKKRRRRRRR
3312321RKKKRRRRRR
4313318KKKRRR
5314322KKRRRRRRR
6315320KRRRRR
7316322RRRRRRR
8316323RRRRRRRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT7834500.0KT783450.1 Triticum aestivum NAC transcription factor 29 (NAC29) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020161118.11e-138protein ATAF2-like
TrEMBLM7ZVD90.0M7ZVD9_TRIUA; NAC domain-containing protein 29
STRINGTRIUR3_32890-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.17e-24NAC-like, activated by AP3/PI