PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_32790-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 163aa MW: 17595.7 Da PI: 6.789 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 123.9 | 6.6e-39 | 26 | 115 | 6 | 95 |
NF-YB 6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 lP+anv+r+m++vlP+n ki++ ak+++++c++ef++fv++eas++++ e+r+t++++d+ w+ +lG++ yv+p+++yl+ yre + TRIUR3_32790-P1 26 SALPMANVVRLMRRVLPSNVKIAETAKQLTHDCAVEFVGFVGGEASERARSEHRRTVAPEDFTWSCQSLGLDSYVQPMQTYLHGYREYDI 115 689***********************************************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.4E-29 | 24 | 121 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.22E-23 | 27 | 117 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.6E-15 | 28 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.3E-6 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 8.3E-6 | 74 | 92 | No hit | No description |
PRINTS | PR00615 | 8.3E-6 | 93 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MGGSSKKRGG QRGEGDAENP AAEGGSALPM ANVVRLMRRV LPSNVKIAET AKQLTHDCAV 60 EFVGFVGGEA SERARSEHRR TVAPEDFTWS CQSLGLDSYV QPMQTYLHGY REYDIARGRS 120 SRGARPPAPP AIASFLPPGQ PGTVTEEELE FLRSVVPPPP EGY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-28 | 23 | 112 | 8 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May act through association with MADS-box proteins. May regulate the expression of genes involved in flowering. {ECO:0000269|PubMed:11971906}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020175589.1 | 1e-103 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q6Z348 | 4e-43 | NFYB1_ORYSJ; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | M7YKD1 | 1e-115 | M7YKD1_TRIUA; Nuclear transcription factor Y subunit B-1 | ||||
STRING | TRIUR3_32790-P1 | 1e-116 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP13659 | 26 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 2e-22 | nuclear factor Y, subunit B6 |