PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_32159-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family TALE
Protein Properties Length: 650aa    MW: 72216.2 Da    PI: 5.8839
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_32159-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.1e-094094461954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  TRIUR3_32159-P1 409 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 446
                      664459******************************88 PP

2BELL118.23.9e-38272343172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      e+qelq+k akL+ +l+eVd++Yk+y++q+q v++sF++vag gsakpYt++Al++iSrhFrcLkdai +qi
  TRIUR3_32159-P1 272 EKQELQNKMAKLMAMLDEVDRKYKHYYHQMQNVVASFDMVAGPGSAKPYTAVALQTISRHFRCLKDAINDQI 343
                      689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.0E-55199341IPR006563POX domain
PfamPF075263.0E-50205339IPR006563POX domain
PROSITE profilePS5007112.357387450IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.1E-28389460IPR009057Homeodomain-like
SMARTSM003893.0E-9390454IPR001356Homeobox domain
CDDcd000867.24E-12390451No hitNo description
SuperFamilySSF466894.28E-17391457IPR009057Homeodomain-like
PfamPF059201.1E-17407446IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MATYYSSPGS ERESQDMYSR DPGGASYPMS SALGNLLYLN NPSSGPYTEF SGILQTQQNF  60
MEMPGHGHHS AMSQDSSARE SQDMLASHHG QRSFGHVKDM KNEMLMHMMD GAQSGGAELI  120
HDDPHNGAQF EFGVLNNHDS SDVPVGQGQG QGQGLSLSLN TQILAPSLPY WSIKPDMLTP  180
NSYQESLRID DIRMKNMQSE ASRAIRHSRY LKAAQEVLDE VVNVWKNIKQ KAQKEQAEPG  240
KADGKETDGG PKSEGASQES GANAAPELST AEKQELQNKM AKLMAMLDEV DRKYKHYYHQ  300
MQNVVASFDM VAGPGSAKPY TAVALQTISR HFRCLKDAIN DQINVIRKKL GEEENSSSKE  360
GKLTRLRYID QQLRQQRAFQ QYGMIPQNAW RPQRGLPENS VTVLRAWLFE HFLHPYPKDS  420
EKLMLARQTG LTRSQISNWF INARVRLWKP MIEDMYKEET GDLEQDSNSS SDNVSRSKNK  480
VASSEENEDL KNARARVCET SQLSESRASM GTMNVGGAPV SFQNEANPDD SFMNLMMKDQ  540
RSGEADGGLL LHNAVAQHSD ENARFMAYHL AELGRYGNGN VSLTLGLQHS GSGLSVPNAQ  600
ANFPGVSDDD IYNAGAPLGV SIASSDYESL NQMDQRQRFE QSPLLHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A6e-16396453158Homeobox protein Meis1
4xrs_B6e-16396453158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3705760.0AK370576.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2112L06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020196287.10.0BEL1-like homeodomain protein 7
RefseqXP_020196288.10.0BEL1-like homeodomain protein 7
RefseqXP_020196289.10.0BEL1-like homeodomain protein 7
RefseqXP_020196291.10.0BEL1-like homeodomain protein 7
TrEMBLA0A3B6KBA40.0A0A3B6KBA4_WHEAT; Uncharacterized protein
TrEMBLM8APM20.0M8APM2_TRIUA; BEL1-like homeodomain protein 6
STRINGTraes_5AS_B2606FAD3.10.0(Triticum aestivum)
STRINGTRIUR3_32159-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-102BEL1-like homeodomain 6