PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_30803-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 135aa MW: 14712.2 Da PI: 10.7114 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.8 | 4.3e-17 | 61 | 108 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lvd ++ G g+W++ ++ ++R++k+c++rw +yl TRIUR3_30803-P1 61 KGPWTPEEDKQLVDFIQANGHGSWRLLPKLAELNRCGKSCRLRWTNYL 108 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-23 | 52 | 111 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.506 | 56 | 112 | IPR017930 | Myb domain |
SMART | SM00717 | 3.7E-13 | 60 | 110 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 61 | 108 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.43E-22 | 62 | 135 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.32E-11 | 63 | 108 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-7 | 112 | 135 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MAVEVVSSGV VALAAVLRSR LLLLVLVGLA SMTTSSSCSG ARGRSLPMGR APCCDRKGLK 60 KGPWTPEEDK QLVDFIQANG HGSWRLLPKL AELNRCGKSC RLRWTNYLRP DIKRGPFTAE 120 EQKSIVQLHG IVGNK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-16 | 59 | 135 | 5 | 80 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK108621 | 1e-119 | AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020168349.1 | 4e-62 | transcription factor MYB6 | ||||
Swissprot | Q9S9Z2 | 3e-49 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | M7YZA3 | 2e-93 | M7YZA3_TRIUA; Myb-related protein Myb4 | ||||
STRING | TRIUR3_30803-P1 | 3e-94 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5409 | 31 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34670.1 | 2e-50 | myb domain protein 93 |
Publications ? help Back to Top | |||
---|---|---|---|
|