PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_30761-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 120aa MW: 13428.4 Da PI: 5.1887 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 140.8 | 3.4e-44 | 19 | 110 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 vreqdrflP+an+s imkk++ an+ki+kdaketv+ec+sefi f++se sdkcqrek ktin ddllwa+atlGf++y+ep kvyl++yre TRIUR3_30761-P1 19 VREQDRFLPVANISSIMKKAILANGKIAKDAKETVRECISEFI-FIASEVSDKCQREKCKTINIDDLLWAMATLGFQEYIEPPKVYLQNYREG 110 69****************************************9.***********************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.2E-38 | 18 | 111 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.39E-26 | 22 | 110 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-17 | 25 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MSDVPASPPG GDNGGFGGVR EQDRFLPVAN ISSIMKKAIL ANGKIAKDAK ETVRECISEF 60 IFIASEVSDK CQREKCKTIN IDDLLWAMAT LGFQEYIEPP KVYLQNYREG HAHLAMWDFF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 4e-36 | 20 | 109 | 3 | 93 | NF-YB |
4awl_B | 4e-36 | 20 | 109 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 4e-36 | 20 | 109 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT009078 | 1e-106 | BT009078.1 Triticum aestivum clone wkm1c.pk0002.d7:fis, full insert mRNA sequence. | |||
GenBank | KM078735 | 1e-106 | KM078735.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A2) mRNA, complete cds. | |||
GenBank | KM078736 | 1e-106 | KM078736.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-B2) mRNA, complete cds. | |||
GenBank | KM078737 | 1e-106 | KM078737.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020150941.1 | 9e-62 | nuclear transcription factor Y subunit B-like | ||||
Swissprot | P25209 | 9e-50 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | T1NJC0 | 3e-85 | T1NJC0_TRIUA; Uncharacterized protein | ||||
STRING | TRIUR3_30761-P1 | 4e-86 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.7 | 1e-52 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|