PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_29857-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 568aa    MW: 62249.7 Da    PI: 7.2438
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_29857-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-52802071128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+ +yL+++++++++++ ++i++vdiyk++Pw Lp+k++ +++ewyfF++rd+ky++g r+nra+ sgyWkatg+dk++ +
  TRIUR3_29857-P1  80 LPPGFRFHPTDEELILHYLRNRAAESPCPV-SIIADVDIYKFDPWALPSKASYGDREWYFFTPRDRKYPNGVRPNRAAGSGYWKATGTDKPIRC 172
                      79****************************.89***************988899**************************************99 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +ge vg+kk Lvfykgr pkg kt+W+mheyrl
  TRIUR3_29857-P1 173 SaTGESVGVKKALVFYKGRPPKGIKTNWIMHEYRL 207
                      878999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-6373241IPR003441NAC domain
PROSITE profilePS5100561.49380241IPR003441NAC domain
PfamPF023656.4E-2781207IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MAAMCADRQI LEERLVFKAT VDTATRETMG DTAGIQAVLP IKLGLSLFVH AHSRSTRLLI  60
KANMLNARGV AMIMSDPAML PPGFRFHPTD EELILHYLRN RAAESPCPVS IIADVDIYKF  120
DPWALPSKAS YGDREWYFFT PRDRKYPNGV RPNRAAGSGY WKATGTDKPI RCSATGESVG  180
VKKALVFYKG RPPKGIKTNW IMHEYRLAAA DAHAANTYRP MKFRNASMRL DDWVLCRIYK  240
KTSQASPMAV PPLSDHELDE PSGAAAYPMS SAGMIMQGGA GGYPLQAAAG GTQRMPKIPS  300
ISELLNEYSL AQLFEDSGHA LMARHDQHAA LLGHPIMSQF HVNGMPQLGQ MDSSASTSVG  360
GEGAAGKRKR PSEDGDRNGS TSQPAAAAEM LIHRAKKPNL ALKAKLSIEE EEEEEEESNP  420
EDTKEDNGGK LIRKDKAKSF PNKSNFTKKT PPKALVVQEE YNEDDNDDED DESVAMASVA  480
IAMNPRVSLF NSPNESITAK CLMAKATNKV TPNIKTTIIN HPSPTDNINE FEGANVEANE  540
FEAFMGKLKG KSKKHFVALL EQLGEPMT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-718024520172NAC domain-containing protein 19
3swm_B3e-718024520172NAC domain-containing protein 19
3swm_C3e-718024520172NAC domain-containing protein 19
3swm_D3e-718024520172NAC domain-containing protein 19
3swp_A3e-718024520172NAC domain-containing protein 19
3swp_B3e-718024520172NAC domain-containing protein 19
3swp_C3e-718024520172NAC domain-containing protein 19
3swp_D3e-718024520172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2510580.0AK251058.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf97a05, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020162550.10.0NAC transcription factor NAM-B1-like
TrEMBLM7ZJC30.0M7ZJC3_TRIUA; NAC domain-containing protein 29
STRINGTRIUR3_29857-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-83NAC-like, activated by AP3/PI