PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_29543-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 139aa    MW: 16548.1 Da    PI: 10.1601
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_29543-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.33.6e-5021263128
              NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                      pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  ++
  TRIUR3_29543-P1   2 PGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGEN 94 
                      9***************************.89***************7777899***************************************** PP

              NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++ +glkktLvfy+g+apkg++++W+m+eyrl
  TRIUR3_29543-P1  95 SRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 126
                      ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100551.5371139IPR003441NAC domain
SuperFamilySSF1019415.49E-542132IPR003441NAC domain
PfamPF023658.8E-262126IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MPGFRFHPTE EELIEFYLRR KVEGRRFNVE LITFLDLYRF DPWELPAMAV IGEKEWFFYV  60
PRDRKYRNGD RPNRVTASGY WKATGADRMI RGENSRPIGL KKTLVFYSGK APKGVRSSWI  120
MNEYRLPPPT TDADLFYKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-54213019146NO APICAL MERISTEM PROTEIN
1ut4_B1e-54213019146NO APICAL MERISTEM PROTEIN
1ut7_A1e-54213019146NO APICAL MERISTEM PROTEIN
1ut7_B1e-54213019146NO APICAL MERISTEM PROTEIN
3swm_A1e-54213022149NAC domain-containing protein 19
3swm_B1e-54213022149NAC domain-containing protein 19
3swm_C1e-54213022149NAC domain-containing protein 19
3swm_D1e-54213022149NAC domain-containing protein 19
3swp_A1e-54213022149NAC domain-containing protein 19
3swp_B1e-54213022149NAC domain-containing protein 19
3swp_C1e-54213022149NAC domain-containing protein 19
3swp_D1e-54213022149NAC domain-containing protein 19
4dul_A1e-54213019146NAC domain-containing protein 19
4dul_B1e-54213019146NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1029021e-155AK102902.1 Oryza sativa Japonica Group cDNA clone:J033113D13, full insert sequence.
GenBankFR8197621e-155FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020183242.12e-98transcription factor JUNGBRUNNEN 1-like
SwissprotQ9ZVP82e-85NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A452Z4X84e-98A0A452Z4X8_AEGTS; Uncharacterized protein
TrEMBLA0A452Z5116e-98A0A452Z511_AEGTS; Uncharacterized protein
STRINGEMT071516e-98(Aegilops tauschii)
STRINGOMERI05G13800.17e-98(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.28e-88NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]