PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_28259-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 325aa    MW: 35834.7 Da    PI: 6.5081
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_28259-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM124.58.6e-39101271129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeel+ +yLkkk+  +k++l evi+evd++k+ePwdL++  ++ +  ++ewyfFs++d+k            +g+ katg+dk 
  TRIUR3_28259-P1  10 VPPGFRFHPTDEELLLYYLKKKIGFEKFDL-EVIREVDLNKIEPWDLQErcRIGSaPQNEWYFFSHKDRK------------AGFLKATGRDKC 90 
                      69****************************.99**************963433332566*******9886............599********* PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + + + +++g++ktLvfy+grap+g+k+dW+mheyrle
  TRIUR3_28259-P1  91 IRT-SYRKIGMRKTLVFYRGRAPHGQKSDWIMHEYRLE 127
                      **9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-486149IPR003441NAC domain
PROSITE profilePS5100541.70610149IPR003441NAC domain
PfamPF023659.2E-2311126IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MADFSSSNGV PPGFRFHPTD EELLLYYLKK KIGFEKFDLE VIREVDLNKI EPWDLQERCR  60
IGSAPQNEWY FFSHKDRKAG FLKATGRDKC IRTSYRKIGM RKTLVFYRGR APHGQKSDWI  120
MHEYRLEEID EAQGGTSEDG WVVCRVFKKK CFFKIAGGGE GSSSQSADAG GGHMAVSSPL  180
GGHDHADRAA MASHYMHGMH PQYHPQHASS FYYSQMQPPE AAYSHHVQVQ DLLTNHRPAA  240
DAAGGGYDFS SLPVEHPGLD VGSSDGVAAD GLAEGRDQTN GAADQQWQPM DGFSNGGGAA  300
AVQQMSAMNS GQRGGEMDLW GYGSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-441015017166NO APICAL MERISTEM PROTEIN
1ut4_B4e-441015017166NO APICAL MERISTEM PROTEIN
1ut7_A4e-441015017166NO APICAL MERISTEM PROTEIN
1ut7_B4e-441015017166NO APICAL MERISTEM PROTEIN
3swm_A5e-441015020169NAC domain-containing protein 19
3swm_B5e-441015020169NAC domain-containing protein 19
3swm_C5e-441015020169NAC domain-containing protein 19
3swm_D5e-441015020169NAC domain-containing protein 19
3swp_A5e-441015020169NAC domain-containing protein 19
3swp_B5e-441015020169NAC domain-containing protein 19
3swp_C5e-441015020169NAC domain-containing protein 19
3swp_D5e-441015020169NAC domain-containing protein 19
4dul_A4e-441015017166NAC domain-containing protein 19
4dul_B4e-441015017166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715423e-89EU971542.1 Zea mays clone 366845 NAC domain-containing protein 76 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020155185.10.0protein BEARSKIN1
SwissprotQ9SV872e-95BRN2_ARATH; Protein BEARSKIN2
TrEMBLM7YAX30.0M7YAX3_TRIUA; Protein BEARSKIN1
STRINGTRIUR3_28259-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.13e-77NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]