PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_27902-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 139aa    MW: 15643.8 Da    PI: 8.1346
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_27902-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.3e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d++ ++G  +W+t++ + g+ R +k+c++rw +yl
  TRIUR3_27902-P1 15 KGLWSPEEDQKLRDYIVRYGHSCWSTVPVKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding33.68.9e-1169104239
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 
                      g ++ eE+e    +++ lG++ W+ Ia++++ gRt+++
  TRIUR3_27902-P1  69 GMFSREEEETVMSLHATLGNK-WSQIAQHLP-GRTDNE 104
                      56999****************.*********.****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.5771066IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-211065IPR009057Homeodomain-like
SuperFamilySSF466891.22E-2513104IPR009057Homeodomain-like
SMARTSM007171.2E-101464IPR001005SANT/Myb domain
PfamPF002492.2E-131562IPR001005SANT/Myb domain
CDDcd001671.03E-91862No hitNo description
PROSITE profilePS500907.73563104IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.7E-1866104IPR009057Homeodomain-like
SMARTSM007172.767109IPR001005SANT/Myb domain
PfamPF002491.6E-969104IPR001005SANT/Myb domain
CDDcd001671.91E-671104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MGCKSCQKPK AQHRKGLWSP EEDQKLRDYI VRYGHSCWST VPVKAGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSREEEETVM SLHATLGNKW SQIAQHLPGR TDNEGLGDGG ICWEFEADMQ  120
GGGAGFCDLL SMSEFLGIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-2015103794B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3705131e-151AK370513.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2111O05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020156819.12e-72transcription factor LAF1-like
SwissprotQ9M0K49e-52LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A446L9J51e-100A0A446L9J5_TRITD; Uncharacterized protein
TrEMBLM8AQ061e-100M8AQ06_TRIUA; Transcription factor LAF1
STRINGTRIUR3_27902-P11e-100(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.14e-54myb domain protein 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]