![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_27902-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 139aa MW: 15643.8 Da PI: 8.1346 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.9 | 7.3e-16 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++l d++ ++G +W+t++ + g+ R +k+c++rw +yl TRIUR3_27902-P1 15 KGLWSPEEDQKLRDYIVRYGHSCWSTVPVKAGLQRNGKSCRLRWINYL 62 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 33.6 | 8.9e-11 | 69 | 104 | 2 | 39 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 g ++ eE+e +++ lG++ W+ Ia++++ gRt+++ TRIUR3_27902-P1 69 GMFSREEEETVMSLHATLGNK-WSQIAQHLP-GRTDNE 104 56999****************.*********.****96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.577 | 10 | 66 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-21 | 10 | 65 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.22E-25 | 13 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-10 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-13 | 15 | 62 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.03E-9 | 18 | 62 | No hit | No description |
PROSITE profile | PS50090 | 7.735 | 63 | 104 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 6.7E-18 | 66 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.7 | 67 | 109 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-9 | 69 | 104 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.91E-6 | 71 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MGCKSCQKPK AQHRKGLWSP EEDQKLRDYI VRYGHSCWST VPVKAGLQRN GKSCRLRWIN 60 YLRPGLKHGM FSREEEETVM SLHATLGNKW SQIAQHLPGR TDNEGLGDGG ICWEFEADMQ 120 GGGAGFCDLL SMSEFLGIN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-20 | 15 | 103 | 7 | 94 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK370513 | 1e-151 | AK370513.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2111O05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020156819.1 | 2e-72 | transcription factor LAF1-like | ||||
Swissprot | Q9M0K4 | 9e-52 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | A0A446L9J5 | 1e-100 | A0A446L9J5_TRITD; Uncharacterized protein | ||||
TrEMBL | M8AQ06 | 1e-100 | M8AQ06_TRIUA; Transcription factor LAF1 | ||||
STRING | TRIUR3_27902-P1 | 1e-100 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1707 | 37 | 109 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G25560.1 | 4e-54 | myb domain protein 18 |
Publications ? help Back to Top | |||
---|---|---|---|
|